STK38L Antibody - #DF9885
| Product: | STK38L Antibody |
| Catalog: | DF9885 |
| Description: | Rabbit polyclonal antibody to STK38L |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 54 kDa; 54kD(Calculated). |
| Uniprot: | Q9Y2H1 |
| RRID: | AB_2843079 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9885, RRID:AB_2843079.
Fold/Unfold
KIAA0965; NDR2; NDR2 protein kinase; nuclear Dbf2 related 2; Nuclear Dbf2 related kinase 2; Nuclear Dbf2-related kinase 2; Serine/threonine protein kinase 38 like; Serine/threonine-protein kinase 38-like; ST38L_HUMAN; Stk38l;
Immunogens
- Q9Y2H1 ST38L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y2H1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K73 | Ubiquitination | Uniprot | |
| T75 | Phosphorylation | Uniprot | |
| K94 | Ubiquitination | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| Y116 | Phosphorylation | Uniprot | |
| K119 | Ubiquitination | Uniprot | |
| K123 | Ubiquitination | Uniprot | |
| K129 | Ubiquitination | Uniprot | |
| K215 | Ubiquitination | Uniprot | |
| K224 | Ubiquitination | Uniprot | |
| K228 | Ubiquitination | Uniprot | |
| T236 | Phosphorylation | Uniprot | |
| K239 | Ubiquitination | Uniprot | |
| S265 | Phosphorylation | Uniprot | |
| K266 | Ubiquitination | Uniprot | |
| S282 | Phosphorylation | Q9Y2H1 (STK38L) | Uniprot |
| T283 | Phosphorylation | Uniprot | |
| T286 | Phosphorylation | Uniprot | |
| Y289 | Phosphorylation | Uniprot | |
| K355 | Ubiquitination | Uniprot | |
| K378 | Ubiquitination | Uniprot | |
| K403 | Ubiquitination | Uniprot | |
| Y441 | Phosphorylation | Uniprot | |
| T442 | Phosphorylation | Q9Y6E0 (STK24) | Uniprot |
| Y443 | Phosphorylation | Uniprot | |
| T450 | Phosphorylation | Uniprot | |
| R452 | Methylation | Uniprot | |
| S454 | Phosphorylation | Uniprot | |
| K460 | Ubiquitination | Uniprot |
PTMs - Q9Y2H1 As Enzyme
Research Backgrounds
Involved in the regulation of structural processes in differentiating and mature neuronal cells.
Cytoplasm. Cytoplasm>Cytoskeleton. Membrane.
Note: Associated with the actin cytoskeleton. Co-localizes with STK24/MST3 in the membrane.
Ubiquitously expressed with highest levels observed in the thymus.
Homodimeric S100B binds two molecules of STK38L. Interacts with MICAL1; leading to inhibit the protein kinase activity by antagonizing activation by MST1/STK4 (By similarity). Interacts with MOB1 and MOB2.
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.