RHOXF1 Antibody - #DF9869
Product: | RHOXF1 Antibody |
Catalog: | DF9869 |
Description: | Rabbit polyclonal antibody to RHOXF1 |
Application: | WB IHC |
Reactivity: | Human |
Mol.Wt.: | 21 kDa; 21kD(Calculated). |
Uniprot: | Q8NHV9 |
RRID: | AB_2843063 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9869, RRID:AB_2843063.
Fold/Unfold
homeobox protein, PEPP subfamily, 1; OTEX; Ovary, testis and epididymis expressed gene protein; Ovary-; Paired like homeobox protein OTEX; Paired like homeobox protein PEPP 1; Paired-like homeobox protein PEPP-1; PEPP subfamily gene 1; PEPP1; Rhox homeobox family member 1; RHOXF1; RHXF1_HUMAN; testis- and epididymis-expressed gene protein;
Immunogens
Ovary, testis and epididymis. Also detected in the prostate and the mammary gland. Expressed in many tumor cell lines derived from acute lymphocytic leukemia, prostate, endometrial adenocarcinoma, melanoma, bladder carcinoma, colon carcinoma, erythroleukemia and breast carcinoma. Not expressed in placenta. In testis, mainly expressed in germ cells, but also detected in somatic cells such as Sertoli cells, Leydig cells and peritubular cells (PubMed:28171660).
- Q8NHV9 RHXF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD
Research Backgrounds
Transcription factor maybe involved in reproductive processes. Modulates expression of target genes encoding proteins involved in processes relevant to spermatogenesis.
Nucleus.
Ovary, testis and epididymis. Also detected in the prostate and the mammary gland. Expressed in many tumor cell lines derived from acute lymphocytic leukemia, prostate, endometrial adenocarcinoma, melanoma, bladder carcinoma, colon carcinoma, erythroleukemia and breast carcinoma. Not expressed in placenta. In testis, mainly expressed in germ cells, but also detected in somatic cells such as Sertoli cells, Leydig cells and peritubular cells.
Does not interact with itself.
Mutagenesis of amino acids 147 to 164 and 155 to 164 lead to a major cytoplasmic localization, with only minor localization in the nucleus.
Belongs to the paired-like homeobox family. PEPP subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.