RGS4 Antibody - #DF9849
| Product: | RGS4 Antibody |
| Catalog: | DF9849 |
| Description: | Rabbit polyclonal antibody to RGS4 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 23,35 kDa; 23kD(Calculated). |
| Uniprot: | P49798 |
| RRID: | AB_2843043 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9849, RRID:AB_2843043.
Fold/Unfold
MGC2124; MGC60244; Regulator of G protein signalling 4; Regulator of G-protein signaling 4; RGP 4; RGP4; RGS 4; RGS4; RGS4_HUMAN; Schizophrenia disorder 9; SCZD 9; SCZD9;
Immunogens
Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum.
- P49798 RGS4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49798 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S103 | Phosphorylation | Uniprot | |
| S108 | Phosphorylation | Uniprot |
Research Backgrounds
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein.
Palmitoylated on Cys-2 and/or Cys-12.
Phosphorylated by cyclic GMP-dependent protein kinase.
Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.