RALB Antibody - #DF9839
| Product: | RALB Antibody |
| Catalog: | DF9839 |
| Description: | Rabbit polyclonal antibody to RALB |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | P11234 |
| RRID: | AB_2843033 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9839, RRID:AB_2843033.
Fold/Unfold
5730472O18Rik; dRalb; GTP binding protein; Ralb; RALB_HUMAN; RAS like protein B; Ras related GTP binding protein B; Ras-related protein Ral-B; v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein); v ral simian leukemia viral oncogene homolog B (ras related); V ral simian leukemia viral oncogene homolog B;
Immunogens
- P11234 RALB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P11234 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S6 | Phosphorylation | Uniprot | |
| K7 | Ubiquitination | Uniprot | |
| S22 | Phosphorylation | Uniprot | |
| Y43 | Phosphorylation | Uniprot | |
| K47 | Ubiquitination | Uniprot | |
| Y51 | Phosphorylation | Uniprot | |
| Y75 | Phosphorylation | Uniprot | |
| Y82 | Phosphorylation | Uniprot | |
| S85 | Phosphorylation | Uniprot | |
| T104 | Phosphorylation | Uniprot | |
| K120 | Ubiquitination | Uniprot | |
| K129 | Ubiquitination | Uniprot | |
| K146 | Ubiquitination | Uniprot | |
| Y154 | Phosphorylation | Uniprot | |
| K160 | Ubiquitination | Uniprot | |
| K179 | Acetylation | Uniprot | |
| K180 | Acetylation | Uniprot | |
| K190 | Acetylation | Uniprot | |
| S198 | Phosphorylation | P17252 (PRKCA) | Uniprot |
Research Backgrounds
Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles (By similarity). Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis. In late stages of cytokinesis, upon completion of the bridge formation between dividing cells, mediates exocyst recruitment to the midbody to drive abscission.
Prenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs).
The farnesylated form confers resistance to the proapoptotic and anti-anchorage-dependent growth effects of geranylgeranyltransferase I inhibitors, including GGTI-2417.
Cell membrane>Lipid-anchor>Cytoplasmic side. Midbody.
Note: During late cytokinesis, enriched at the midbody.
Interacts with EXOC2/Sec5 and EXOC8/Exo84. Interacts (via effector domain) with RALBP1.
Belongs to the small GTPase superfamily. Ras family.
Research Fields
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Colorectal cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.