RAB43 Antibody - #DF9833
| Product: | RAB43 Antibody |
| Catalog: | DF9833 |
| Description: | Rabbit polyclonal antibody to RAB43 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Horse |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | Q86YS6 |
| RRID: | AB_2843027 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9833, RRID:AB_2843027.
Fold/Unfold
RAB41; RAB43; RAB43_HUMAN; Ras related protein Rab 41; Ras related protein Rab 43; Ras-related protein Rab-41; Ras-related protein Rab-43;
Immunogens
Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver.
- Q86YS6 RAB43_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q86YS6 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y15 | Phosphorylation | Uniprot | |
| K31 | Ubiquitination | Uniprot | |
| S44 | Phosphorylation | Uniprot | |
| S49 | Phosphorylation | Uniprot | |
| T50 | Phosphorylation | Uniprot | |
| K65 | Ubiquitination | Uniprot | |
| K68 | Ubiquitination | Uniprot | |
| T74 | Phosphorylation | Uniprot | |
| T82 | Phosphorylation | Uniprot | |
| Y98 | Phosphorylation | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| K132 | Ubiquitination | Uniprot | |
| K192 | Ubiquitination | Uniprot | |
| S193 | Phosphorylation | Uniprot | |
| K202 | Ubiquitination | Uniprot |
Research Backgrounds
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.
Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus. Golgi apparatus>trans-Golgi network membrane>Lipid-anchor. Golgi apparatus>trans-Golgi network.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211).
Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver.
Interacts with GDI1, GDI2, CHM and CHML; phosphorylation at Thr-82 disrupts these interactions.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.