RAB39B Antibody - #DF9829
| Product: | RAB39B Antibody |
| Catalog: | DF9829 |
| Description: | Rabbit polyclonal antibody to RAB39B |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 25 kDa,37kDa; 25kD(Calculated). |
| Uniprot: | Q96DA2 |
| RRID: | AB_2843023 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9829, RRID:AB_2843023.
Fold/Unfold
6330580M05Rik; MRX72; OTTHUMP00000024247; OTTMUSP00000020441; RAB39B, member RAS oncogene family; Ras related protein Rab 39B; RAS-associated protein RAB39B; RP13-228J13.2; RP23-252K7.1;
Immunogens
- Q96DA2 RB39B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96DA2 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T29 | Phosphorylation | Uniprot | |
| T65 | Phosphorylation | Uniprot | |
| S73 | Phosphorylation | Uniprot | |
| K140 | Ubiquitination | Uniprot | |
| K162 | Ubiquitination | Uniprot |
Research Backgrounds
Small GTPases Rab involved in autophagy. The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. May regulate the homeostasis of SNCA/alpha-synuclein. Together with PICK1 proposed to ensure selectively GRIA2 exit from the endoplasmic reticulum to the Golgi and to regulate AMPAR compostion at the post-synapses and thus synaptic transmission (By similarity).
Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasmic vesicle membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus.
Note: Partial colocalization with markers that cycle from the cell surface to the trans-Golgi network.
Highly expressed in the brain.
Interacts (in GTP-bound form) with PICK1 (via PDZ domain); a PICK1 homodimer may allow simultaneous association of RAB39B and GRIA2 to PICK1 which is involved in GRIA2 trafficking.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.