RAB39A Antibody - #DF9828
| Product: | RAB39A Antibody |
| Catalog: | DF9828 |
| Description: | Rabbit polyclonal antibody to RAB39A |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
| Mol.Wt.: | 25 kDa,37kDa; 25kD(Calculated). |
| Uniprot: | Q14964 |
| RRID: | AB_2843022 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9828, RRID:AB_2843022.
Fold/Unfold
rab related GTP binding protein; Rab-39; Rab39; RAB39A; RAB39A member RAS oncogene family; Ras related protein Rab39A; Ras-related protein Rab-39A; RB39A_HUMAN;
Immunogens
- Q14964 RB39A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14964 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K63 | Acetylation | Uniprot | |
| K63 | Ubiquitination | Uniprot | |
| T69 | Phosphorylation | Uniprot | |
| Y114 | Phosphorylation | Uniprot | |
| K144 | Ubiquitination | Uniprot | |
| S205 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K. May be involved in multiple neurite formation (By similarity).
Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side. Lysosome.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis.
Interacts with BECN1. Probably associates with the PI3K (PI3KC3/PI3K-III/class III phosphatidylinositol 3-kinase) complex. Interacts with UACA (By similarity).
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.