RAB23 Antibody - #DF9821
Product: | RAB23 Antibody |
Catalog: | DF9821 |
Description: | Rabbit polyclonal antibody to RAB23 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 27 kDa; 27kD(Calculated). |
Uniprot: | Q9ULC3 |
RRID: | AB_2843015 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9821, RRID:AB_2843015.
Fold/Unfold
DKFZp781H0695; HSPC137; MGC8900; Rab 23; RAB family small GTP binding protein RAB 23; Rab23; RAB23, member RAS oncogene family; RAB23_HUMAN; Ras related protein Rab 23; Ras-related protein Rab-23;
Immunogens
- Q9ULC3 RAB23_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9ULC3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K122 | Ubiquitination | Uniprot | |
K132 | Ubiquitination | Uniprot | |
Y148 | Phosphorylation | Uniprot | |
K163 | Ubiquitination | Uniprot | |
Y164 | Phosphorylation | Uniprot | |
K174 | Ubiquitination | Uniprot | |
T184 | Phosphorylation | Uniprot | |
S186 | Phosphorylation | Uniprot | |
S187 | Phosphorylation | Uniprot | |
T196 | Phosphorylation | Uniprot | |
S200 | Phosphorylation | Uniprot | |
S206 | Phosphorylation | Uniprot | |
T208 | Phosphorylation | Uniprot |
Research Backgrounds
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Together with SUFU, prevents nuclear import of GLI1, and thereby inhibits GLI1 transcription factor activity. Regulates GLI1 in differentiating chondrocytes. Likewise, regulates GLI3 proteolytic processing and modulates GLI2 and GLI3 transcription factor activity. Plays a role in autophagic vacuole assembly, and mediates defense against pathogens, such as S.aureus, by promoting their capture by autophagosomes that then merge with lysosomes.
Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasm. Cytoplasmic vesicle>Autophagosome. Endosome membrane. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis.
Interacts with SUFU.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.