RAB1B Antibody - #DF9818
Product: | RAB1B Antibody |
Catalog: | DF9818 |
Description: | Rabbit polyclonal antibody to RAB1B |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 22 kDa; 22kD(Calculated). |
Uniprot: | Q9H0U4 |
RRID: | AB_2843012 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9818, RRID:AB_2843012.
Fold/Unfold
RAB1B; RAB1B member RAS oncogene family; RAB1B_HUMAN; Ras related protein Rab1B; Ras-related protein Rab-1B; Small GTP binding protein;
Immunogens
- Q9H0U4 RAB1B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H0U4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y5 | Phosphorylation | Uniprot | |
Y7 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
Y33 | Phosphorylation | Uniprot | |
S36 | Phosphorylation | Uniprot | |
Y37 | Phosphorylation | Uniprot | |
T49 | Phosphorylation | Uniprot | |
K55 | Ubiquitination | Uniprot | |
K58 | Acetylation | Uniprot | |
T64 | Phosphorylation | Uniprot | |
T72 | Phosphorylation | Uniprot | |
T74 | Phosphorylation | Uniprot | |
Y77 | Phosphorylation | Uniprot | |
Y78 | Phosphorylation | Uniprot | |
T91 | Phosphorylation | Uniprot | |
Y96 | Phosphorylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
R108 | Methylation | Uniprot | |
S111 | Phosphorylation | Uniprot | |
K116 | Ubiquitination | Uniprot | |
K122 | Ubiquitination | Uniprot | |
S142 | Phosphorylation | Uniprot | |
S179 | Phosphorylation | Uniprot | |
T191 | Phosphorylation | Uniprot |
Research Backgrounds
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments (By similarity). Promotes the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment (By similarity).
Prenylated; by GGTase II, only after interaction of the substrate with Rab escort protein 1 (REP1).
AMPylation at Tyr-77 by L.pneumophila DrrA occurs in the switch 2 region and leads to moderate inactivation of the GTPase activity. It appears to prolong the lifetime of the GTP state of RAB1B by restricting access of GTPase effectors to switch 2 and blocking effector-stimulated GTP hydrolysis, thereby rendering RAB1B constitutively active. It is later de-AMPylated by L.pneumophila SidD, releasing RAB1B from bacterial phagosomes.
Phosphocholinated at Ser-76 by L.pneumophila AnkX, leading to displace GDP dissociation inhibitors (GDI). Both GDP-bound and GTP-bound forms can be phosphocholinated. Dephosphocholinated by L.pneumophila Lem3, restoring accessibility to L.pneumophila GTPase effector LepB.
Cytoplasm. Membrane>Lipid-anchor>Cytoplasmic side. Preautophagosomal structure membrane>Lipid-anchor>Cytoplasmic side. Cytoplasm>Perinuclear region.
Note: Targeted by REP1 to membranes of specific subcellular compartments including endoplasmic reticulum, Golgi apparatus, and intermediate vesicles between these two compartments (PubMed:11389151). In the GDP-form, colocalizes with GDI in the cytoplasm (PubMed:11389151). Co-localizes with MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment and to the peri-Golgi region (By similarity).
Interacts with MICAL1 and MICAL2. Interacts (in GTP-bound form) with MICALCL, MICAL1 and MILCAL3. Interacts with GDI1; the interaction requires the GDP-bound state. Interacts with CHM/REP1; the interaction requires the GDP-bound form and is necessary for prenylation by GGTase II. Interacts with RabGAP TBC1D20. Interacts (in GDP-bound form) with lipid phosphatase MTMR6 (via GRAM domain); the interaction regulates MTMR6 recruitment to the endoplasmic reticulum-Golgi intermediate compartment. Interacts (in GDP-bound form) with lipid phosphatase MTMR7 (By similarity).
(Microbial infection) Interacts with L.pneumophila AnkX. Interacts with L.pneumophila Lem3. Interacts with L.pneumophila SidD. Interacts with L.pneumophila DrrA.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.