RABL5 Antibody - #DF9798
Product: | RABL5 Antibody |
Catalog: | DF9798 |
Description: | Rabbit polyclonal antibody to RABL5 |
Application: | WB IHC |
Reactivity: | Human, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 21 kDa; 21kD(Calculated). |
Uniprot: | Q9H7X7 |
RRID: | AB_2842992 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9798, RRID:AB_2842992.
Fold/Unfold
3110017O03Rik; AI835745; AI847427; DKFZp761N0823; FLJ13225; FLJ14117; MGC109244; RAB member of RAS oncogene family like 5; RAB member RAS oncogene family like 5; Rab-like protein 5; RABL5; RABL5_HUMAN;
Immunogens
- Q9H7X7 IFT22_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H7X7 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S33 | Phosphorylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
S72 | Phosphorylation | Uniprot | |
S135 | Phosphorylation | Uniprot | |
S137 | Phosphorylation | Uniprot | |
K144 | Ubiquitination | Uniprot | |
K163 | Ubiquitination | Uniprot | |
K166 | Ubiquitination | Uniprot | |
S182 | Phosphorylation | Uniprot | |
T185 | Phosphorylation | Uniprot |
Research Backgrounds
Small GTPase-like component of the intraflagellar transport (IFT) complex B.
Cell projection>Cilium.
Component of the IFT complex B, at least composed of IFT20, IFT22, HSPB11/IFT25, IFT27, IFT46, IFT52, TRAF3IP1/IFT54, IFT57, IFT74, IFT80, IFT81, and IFT88. Interacts with IFT88 (By similarity).
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.