S100A7A Antibody - #DF9784
Product: | S100A7A Antibody |
Catalog: | DF9784 |
Description: | Rabbit polyclonal antibody to S100A7A |
Application: | WB IHC |
Reactivity: | Human |
Mol.Wt.: | 11 kDa; 11kD(Calculated). |
Uniprot: | Q86SG5 |
RRID: | AB_2842979 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9784, RRID:AB_2842979.
Fold/Unfold
AY465109; Gm1020; MGC130261; MGC130262; Protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7-like 1; S100 calcium-binding protein A7A; S100a15; S100a15a; S100a17l1; S100A7A; S100A7f; S100A7L1; S1A7A_HUMAN;
Immunogens
- Q86SG5 S1A7A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
PTMs - Q86SG5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
T4 | Phosphorylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
S31 | Phosphorylation | Uniprot | |
T34 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
S97 | Phosphorylation | Uniprot | |
S100 | Phosphorylation | Uniprot |
Research Backgrounds
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
Cytoplasm.
Overexpressed in psoriasis.
Belongs to the S-100 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.