S100A7 Antibody - #DF9783
Product: | S100A7 Antibody |
Catalog: | DF9783 |
Description: | Rabbit polyclonal antibody to S100A7 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 11 kDa; 11kD(Calculated). |
Uniprot: | P31151 |
RRID: | AB_2842978 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9783, RRID:AB_2842978.
Fold/Unfold
HID 5; Protein S100 A7; Protein S100-A7; PSOR 1; PSOR1; Psoriasin 1; Psoriasin; Psoriasin1; S100 Calcium binding protein A7; S100 calcium-binding protein A7; S100A7; S100A7c; S10A7_HUMAN;
Immunogens
Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
- P31151 S10A7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
PTMs - P31151 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
T4 | Phosphorylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
S31 | Phosphorylation | Uniprot | |
T34 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
T52 | Phosphorylation | Uniprot | |
S97 | Phosphorylation | Uniprot | |
S100 | Phosphorylation | Uniprot |
Research Backgrounds
Cytoplasm. Secreted.
Note: Secreted by a non-classical secretory pathway.
Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
Interacts with RANBP9.
Belongs to the S-100 family.
Research Fields
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.