PPP1R14B Antibody - #DF9778
| Product: | PPP1R14B Antibody |
| Catalog: | DF9778 |
| Description: | Rabbit polyclonal antibody to PPP1R14B |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Rabbit, Dog |
| Mol.Wt.: | 16 kDa; 16kD(Calculated). |
| Uniprot: | Q96C90 |
| RRID: | AB_2842973 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9778, RRID:AB_2842973.
Fold/Unfold
PHI 1; PHI1; Phospholipase C beta 3 neighboring gene protein; Phospholipase C beta 3 neighbouring gene protein; Phospholipase C-beta-3 neighbouring gene protein; PLCB3N; PNG; PP14B_HUMAN; Ppp1r14b; Protein phosphatase 1 regulatory (inhibitor) subunit 14B; Protein phosphatase 1 regulatory subunit 14B; SOM172;
Immunogens
- Q96C90 PP14B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96C90 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| S4 | Phosphorylation | Uniprot | |
| S21 | Phosphorylation | Uniprot | |
| R27 | Methylation | Uniprot | |
| Y29 | Phosphorylation | Uniprot | |
| S32 | Phosphorylation | Uniprot | |
| T57 | Phosphorylation | O75116 (ROCK2) , P17252 (PRKCA) , Q05655 (PRKCD) , Q13418 (ILK) | Uniprot |
| K59 | Acetylation | Uniprot | |
| K59 | Methylation | Uniprot | |
| K114 | Ubiquitination | Uniprot | |
| Y121 | Phosphorylation | Uniprot | |
| K122 | Ubiquitination | Uniprot | |
| S142 | Phosphorylation | Uniprot | |
| T143 | Phosphorylation | Uniprot |
Research Backgrounds
Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated (By similarity).
Phosphorylated primarily on Thr-57 by PKC (in vitro). An unknown Ser is also phosphorylated by PKC (in vitro) (By similarity).
Cytoplasm.
Ubiquitous. Expressed at low levels.
Belongs to the PP1 inhibitor family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.