PIGC Antibody - #DF9743
| Product: | PIGC Antibody |
| Catalog: | DF9743 |
| Description: | Rabbit polyclonal antibody to PIGC |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 34 kDa; 34kD(Calculated). |
| Uniprot: | Q92535 |
| RRID: | AB_2842938 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9743, RRID:AB_2842938.
Fold/Unfold
GPI2; Phosphatidylinositol glycan biosynthesis class C protein; Phosphatidylinositol N acetylglucosaminyltransferase subunit C;
Immunogens
- Q92535 PIGC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q92535 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K16 | Ubiquitination | Uniprot | |
| K218 | Acetylation | Uniprot | |
| K221 | Acetylation | Uniprot | |
| K289 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in GPI anchor biosynthesis. Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis (ECO:0000269|.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Associates with PIGA, PIGH, PIGP, PIGQ and DPM2. The latter is not essential for activity.
Belongs to the PIGC family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosylphosphatidylinositol (GPI)-anchor biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.