SLC6A17 Antibody - #DF9727
| Product: | SLC6A17 Antibody |
| Catalog: | DF9727 |
| Description: | Rabbit polyclonal antibody to SLC6A17 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 81 kDa; 81kD(Calculated). |
| Uniprot: | Q9H1V8 |
| RRID: | AB_2842922 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9727, RRID:AB_2842922.
Fold/Unfold
AW490886; D130012J15Rik; NTT4; Orphan sodium and chloride dependent neurotransmitter transporter NTT4; OTTHUMP00000013508; S6A17_HUMAN; Slc6a17; Sodium-dependent neurotransmitter transporter NTT4; Sodium-dependent neutral amino acid transporter SLC6A17; Solute carrier family 6 (neurotransmitter transporter), member 17; Solute carrier family 6 member 17; Solute carrier family 6, member 17;
Immunogens
- Q9H1V8 S6A17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPKNSKVTQREHSSEHVTESVADLLALEEPVDYKQSVLNVAGEAGGKQKAVEEELDAEDRPAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAVGQRIRRGSIGVWHYICPRLGGIGFSSCIVCLFVGLYYNVIIGWSIFYFFKSFQYPLPWSECPVVRNGSVAVVEAECEKSSATTYFWYREALDISDSISESGGLNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVDGILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLGFKANIMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAGITTPIIDTFKVPKEMFTVGCCVFAFLVGLLFVQRSGNYFVTMFDDYSATLPLTLIVILENIAVAWIYGTKKFMQELTEMLGFRPYRFYFYMWKFVSPLCMAVLTTASIIQLGVTPPGYSAWIKEEAAERYLYFPNWAMALLITLIVVATLPIPVVFVLRHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H1V8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K34 | Ubiquitination | Uniprot | |
| K47 | Ubiquitination | Uniprot | |
| K662 | Ubiquitination | Uniprot | |
| K679 | Ubiquitination | Uniprot | |
| S682 | Phosphorylation | Uniprot | |
| S686 | Phosphorylation | Uniprot |
Research Backgrounds
Functions as a sodium-dependent vesicular transporter selective for proline, glycine, leucine and alanine. In contrast to other members of this neurotransmitter transporter family, does not appear to be chloride-dependent (By similarity).
Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Multi-pass membrane protein. Cell junction>Synapse>Postsynapse. Cell junction>Synapse>Presynapse.
Note: Localizes at synaptic junctions - at both pre- and post-synaptic sites - particularly in excitatory glutamatergic terminals.
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A17 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.