NTS Antibody - #DF9703
| Product: | NTS Antibody |
| Catalog: | DF9703 |
| Description: | Rabbit polyclonal antibody to NTS |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 20 kDa; 20kD(Calculated). |
| Uniprot: | P30990 |
| RRID: | AB_2842898 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9703, RRID:AB_2842898.
Fold/Unfold
Human proneurotensin; Large neuromedin N; Neuromedin N preproprotein; Neurotensin/neuromedin N; NEUT_HUMAN; NMN 125; NmN; NmN-125; NN; NT; NT/N; NTRH; NTS; NTS1; Pro neurotensin/neuromedin; Proneuromedin N mRNA; Tail peptide;
Immunogens
- P30990 NEUT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P30990 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y146 | Phosphorylation | Uniprot | |
| Y161 | Phosphorylation | Uniprot | |
| Y168 | Phosphorylation | Uniprot | |
| Y169 | Phosphorylation | Uniprot | |
| Y170 | Phosphorylation | Uniprot |
Research Backgrounds
Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Secreted. Cytoplasmic vesicle>Secretory vesicle.
Note: Packaged within secretory vesicles.
Interacts with NTSR1. Interacts with SORT1. Interacts with SORL1.
Belongs to the neurotensin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.