C3orf31 Antibody - #DF9631
| Product: | C3orf31 Antibody |
| Catalog: | DF9631 |
| Description: | Rabbit polyclonal antibody to C3orf31 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 51 kDa; 51kD(Calculated). |
| Uniprot: | Q96BW9 |
| RRID: | AB_2842827 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9631, RRID:AB_2842827.
Fold/Unfold
CDP-DAG synthase; CDP-diacylglycerol synthase; Chromosome 3 open reading frame 31; MGC16471; Mitochondrial translocator assembly and maintenance protein 41 homolog; MMP37 like protein; MMP37 like protein mitochondrial; Phosphatidate cytidylyltransferase, mitochondrial; RAM41; TAM41; TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae); TAM41_HUMAN; TAMM41; translocator assembly and maintenance, mitochondrial, S. cerevisiae;
Immunogens
- Q96BW9 TAM41_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLSAIVRPSSIRQSTKGIFTAGKSFGNPCVTYLLTEWLPHSWLQCKALYLLGACEMLSFDGHKLGYCSKVQTGITAAEPGGRTMSDHWQCCWKLYCPSEFSETLPVCRVFPSYCFIYQSYRCIGLQKQQHLCSPSSSPSLRQLLPSVLVGYFCCYCHFSKW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96BW9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S18 | Phosphorylation | Uniprot | |
| T54 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the formation of CDP-diacylglycerol (CDP-DAG) from phosphatidic acid (PA) in the mitochondrial inner membrane. Required for the biosynthesis of the dimeric phospholipid cardiolipin, which stabilizes supercomplexes of the mitochondrial respiratory chain in the mitochondrial inner membrane.
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Belongs to the TAM41 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.