MID1IP1 Antibody - #DF9624
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9624, RRID:AB_2842820.
Fold/Unfold
3110038L01Rik; FLJ10386; G12 like; Gastrulation specific G12 like protein; Gastrulation-specific G12-like protein; M1IP1_HUMAN; MGC72582; MID1 interacting G12 like protein; MID1 interacting protein 1 (gastrulation specific G12 like); Mid1-interacting G12-like protein; Mid1-interacting protein 1; Mid1ip1; MIG12; OTTMUSP00000018143; OTTMUSP00000018222; OTTMUSP00000018284; OTTMUSP00000018285; Protein STRAIT11499; Protein STRAIT11499 homolog; RP23-130J1.1; S14R; Slap; Spot 14 like androgen inducible protein; Spot 14 related protein; Spot 14-R; Spot 14-related protein; STRAIT11499; THRSPL;
Immunogens
- Q9NPA3 M1IP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NPA3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K11 | Ubiquitination | Uniprot | |
| S59 | Phosphorylation | Uniprot | |
| T67 | Phosphorylation | Uniprot | |
| S73 | Phosphorylation | Uniprot | |
| S75 | Phosphorylation | Uniprot | |
| S79 | Phosphorylation | Uniprot | |
| S89 | Phosphorylation | Uniprot | |
| Y91 | Phosphorylation | Uniprot | |
| K95 | Ubiquitination | Uniprot | |
| S96 | Phosphorylation | Uniprot | |
| K122 | Ubiquitination | Uniprot | |
| K124 | Ubiquitination | Uniprot | |
| S159 | Phosphorylation | Uniprot | |
| K160 | Ubiquitination | Uniprot | |
| K164 | Ubiquitination | Uniprot | |
| K173 | Ubiquitination | Uniprot |
Research Backgrounds
Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).
Nucleus. Cytoplasm. Cytoplasm>Cytoskeleton.
Note: Associated with microtubules.
Homodimer in the absence of THRSP. Heterodimer with THRSP. The homodimer interacts with ACACA and ACACB. Promotes polymerization of Acetyl-CoA carboxylase to form complexes that contain MID1IP1 and ACACA and/or ACACB. Interaction with THRSP interferes with ACACA binding (By similarity).
Belongs to the SPOT14 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.