VPREB1 Antibody - #DF9594
Product: | VPREB1 Antibody |
Catalog: | DF9594 |
Description: | Rabbit polyclonal antibody to VPREB1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig |
Mol.Wt.: | 17 kDa; 17kD(Calculated). |
Uniprot: | P12018 |
RRID: | AB_2842790 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9594, RRID:AB_2842790.
Fold/Unfold
CD179 antigen like family member A; CD179 antigen-like family member A; CD179a; IGI; IGVPB; Immunoglobulin iota chain; Pre B lymphocyte 1; pre-B lymphocyte 1; Protein VPreB1; V(pre)B protein; VPREB 1; VPREB; VpreB protein; VPREB_HUMAN; VPREB1;
Immunogens
- P12018 VPREB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P12018 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot |
Research Backgrounds
Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
Only expressed by pre-B-cells.
Associates non-covalently with IGLL1.
Belongs to the immunoglobulin superfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.