GTPBP5 Antibody - #DF9550
| Product: | GTPBP5 Antibody |
| Catalog: | DF9550 |
| Description: | Rabbit polyclonal antibody to GTPBP5 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Chicken |
| Mol.Wt.: | 44 kDa; 44kD(Calculated). |
| Uniprot: | Q9H4K7 |
| RRID: | AB_2842746 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9550, RRID:AB_2842746.
Fold/Unfold
dJ1005F21.2; FLJ10741; GTP binding protein 5 (putative); GTP binding protein 5; GTP-binding protein 5; GTPB5_HUMAN; GTPBP5; Mitochondrial ribosome-associated GTPase 2; ObgH1; Protein obg homolog 1;
Immunogens
- Q9H4K7 MTG2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H4K7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K123 | Ubiquitination | Uniprot | |
| S357 | Phosphorylation | Uniprot | |
| Y389 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays GTPase activity. Involved in the ribosome maturation process.
Mitochondrion. Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Associates with the mitochondrial ribosome large subunit; the association occurs in a GTP-dependent manner.
Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.