GIMAP7 Antibody - #DF9547
| Product: | GIMAP7 Antibody |
| Catalog: | DF9547 |
| Description: | Rabbit polyclonal antibody to GIMAP7 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Dog |
| Mol.Wt.: | 35 kDa; 35kD(Calculated). |
| Uniprot: | Q8NHV1 |
| RRID: | AB_2842743 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9547, RRID:AB_2842743.
Fold/Unfold
GTPase IMAP family member 7; hIAN7; IAN 7; IAN7; Immune associated nucleotide; immunity associated nucleotide 7 protein; MGC27027;
Immunogens
Most abundantly expressed in spleen, lymph nodes, and fetal kidney, but also present in the heart and the small intestine. Lower expression levels are found in lung, kidney, liver, and thyroid, salivary, and mammary glands. Also detected in the thymus (PubMed:15474311). Detected in T-cells (PubMed:23454188).
- Q8NHV1 GIMA7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8NHV1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S8 | Phosphorylation | Uniprot | |
| K16 | Ubiquitination | Uniprot | |
| K21 | Ubiquitination | Uniprot | |
| K45 | Ubiquitination | Uniprot | |
| K49 | Ubiquitination | Uniprot | |
| T64 | Phosphorylation | Uniprot | |
| K71 | Ubiquitination | Uniprot | |
| K79 | Ubiquitination | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| K116 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot | |
| K125 | Ubiquitination | Uniprot | |
| T132 | Phosphorylation | Uniprot | |
| K154 | Ubiquitination | Uniprot | |
| K158 | Ubiquitination | Uniprot | |
| K171 | Ubiquitination | Uniprot | |
| T173 | Phosphorylation | Uniprot | |
| K178 | Ubiquitination | Uniprot | |
| S180 | Phosphorylation | Uniprot | |
| Y200 | Phosphorylation | Uniprot | |
| Y206 | Phosphorylation | Uniprot | |
| K207 | Ubiquitination | Uniprot | |
| K222 | Ubiquitination | Uniprot |
Research Backgrounds
The dimer has GTPase activity; the active site contains residues from both subunits.
Lipid droplet. Cytoplasm. Endoplasmic reticulum. Golgi apparatus.
Note: Colocalizes with GIMAP2 on the surface of cytoplasmic lipid droplets.
Most abundantly expressed in spleen, lymph nodes, and fetal kidney, but also present in the heart and the small intestine. Lower expression levels are found in lung, kidney, liver, and thyroid, salivary, and mammary glands. Also detected in the thymus. Detected in T-cells.
Monomer in the presence of bound GDP and in the absence of bound nucleotide. Homodimer in the presence of bound GTP. Heterodimer with GIMAP2.
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. AIG1/Toc34/Toc159-like paraseptin GTPase family. IAN subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.