MARCH9 Antibody - #DF9485
| Product: | MARCH9 Antibody |
| Catalog: | DF9485 |
| Description: | Rabbit polyclonal antibody to MARCH9 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig |
| Mol.Wt.: | 38 kDa; 38kD(Calculated). |
| Uniprot: | Q86YJ5 |
| RRID: | AB_2842681 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9485, RRID:AB_2842681.
Fold/Unfold
BC019560; E3 ubiquitin protein ligase MARCH9; FLJ36578; MARCH IX; Membrane associated RING CH protein IX; membrane associated ring finger (C3HC4) 9; Membrane associated RING finger protein 9; RING finger protein 179; RNF179;
Immunogens
- Q86YJ5 MARH9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYGSEPRARGLAGDKEPRAGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q86YJ5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K281 | Ubiquitination | Uniprot | |
| S331 | Phosphorylation | Uniprot |
Research Backgrounds
E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Golgi apparatus membrane>Multi-pass membrane protein. Lysosome membrane>Multi-pass membrane protein.
Ubiquitously expressed.
Homodimer.
The RING-CH-type zinc finger domain is required for E3 ligase activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.