MARCH8 Antibody - #DF9484
| Product: | MARCH8 Antibody |
| Catalog: | DF9484 |
| Description: | Rabbit polyclonal antibody to MARCH8 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine |
| Mol.Wt.: | 33 kDa; 33kD(Calculated). |
| Uniprot: | Q5T0T0 |
| RRID: | AB_2842680 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9484, RRID:AB_2842680.
Fold/Unfold
c MIR; c-MIR; Cellular modulator of immune recognition; E3 ubiquitin protein ligase MARCH8; E3 ubiquitin-protein ligase MARCH8; MARCH 8; MARCH VIII; MARCH-VIII; MARCH8; MARH8_HUMAN; Membrane associated RING CH protein VIII; Membrane associated ring finger (C3HC4) 8; Membrane associated RING finger protein 8; Membrane-associated RING finger protein 8; Membrane-associated RING-CH protein VIII; MIR; OTTHUMP00000058921; RING finger protein 178; RNF178;
Immunogens
- Q5T0T0 MARH8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q5T0T0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S71 | Phosphorylation | Uniprot | |
| Y237 | Phosphorylation | Uniprot | |
| S253 | Phosphorylation | Uniprot |
Research Backgrounds
E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
Cytoplasmic vesicle membrane>Multi-pass membrane protein. Lysosome membrane>Multi-pass membrane protein. Early endosome membrane>Multi-pass membrane protein.
Broadly expressed. Present in immature dendritic cells (at protein level).
Interacts with CD86.
The RING-CH-type zinc finger domain is required for E3 ligase activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.