MARCH1 Antibody - #DF9481
| Product: | MARCH1 Antibody |
| Catalog: | DF9481 |
| Description: | Rabbit polyclonal antibody to MARCH1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Rabbit, Chicken |
| Mol.Wt.: | 32 kDa; 32kD(Calculated). |
| Uniprot: | Q8TCQ1 |
| RRID: | AB_2842677 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9481, RRID:AB_2842677.
Fold/Unfold
DKFZp564M1682; E3 ubiquitin protein ligase MARCH1; E3 ubiquitin-protein ligase MARCH1; FLJ20668; MARCH 1; MARCH-I; March1; MARH1_HUMAN; Membrane associated RING CH protein I; Membrane associated ring finger (C3HC4) 1; Membrane associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase; Membrane associated RING finger protein 1; Membrane-associated RING finger protein 1; Membrane-associated RING-CH protein I; RING finger protein 171; RNF171;
Immunogens
Expressed in antigen presenting cells, APCs, located in lymph nodes and spleen. Also expressed in lung. Expression is high in follicular B-cells, moderate in dendritic cells and low in splenic T-cells.
- Q8TCQ1 MARH1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLGWCEAIARNPHRIPNNTRTPEISGDLADASQTSTLNEKSPGRSASRSSNISKASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGNDNGVLEWPFWTKLVVVAIGFTGGLVFMYVQCKVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8TCQ1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T60 | Phosphorylation | Uniprot | |
| T160 | Phosphorylation | Uniprot |
Research Backgrounds
E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, down-regulates their cell surface localization thus sequestering them in the intracellular endosomal system.
Has a short half-life. Instability/short half-life permits rapid changes that allow efficient induction of antigen presentation once antigen presenting cells, APCs, receive maturation signals. Small changes in protein levels significantly alter the cell surface display of MHC class II proteins (By similarity).
Golgi apparatus>trans-Golgi network membrane>Multi-pass membrane protein. Lysosome membrane>Multi-pass membrane protein. Cytoplasmic vesicle membrane>Multi-pass membrane protein. Late endosome membrane>Multi-pass membrane protein. Early endosome membrane>Multi-pass membrane protein. Cell membrane>Multi-pass membrane protein.
Expressed in antigen presenting cells, APCs, located in lymph nodes and spleen. Also expressed in lung. Expression is high in follicular B-cells, moderate in dendritic cells and low in splenic T-cells.
The RING-CH-type zinc finger domain is required for E3 ligase activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.