GINS1 Antibody - #DF9450
| Product: | GINS1 Antibody |
| Catalog: | DF9450 |
| Description: | Rabbit polyclonal antibody to GINS1 |
| Application: | WB |
| Reactivity: | Human, Monkey |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | Q14691 |
| RRID: | AB_2842646 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9450, RRID:AB_2842646.
Fold/Unfold
DNA replication complex GINS protein PSF1; GINS complex subunit 1 (Psf1 homolog); GINS complex subunit 1; GINS1; partner of sld five-1; partner of sld5; PSF1 homolog; PSF1_HUMAN; RP4-691N24.2;
Immunogens
- Q14691 PSF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14691 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K5 | Ubiquitination | Uniprot | |
| K37 | Ubiquitination | Uniprot | |
| Y40 | Phosphorylation | Uniprot | |
| S45 | Phosphorylation | Uniprot | |
| K51 | Ubiquitination | Uniprot | |
| S52 | Phosphorylation | Uniprot | |
| S56 | Phosphorylation | Uniprot | |
| K63 | Acetylation | Uniprot | |
| K63 | Ubiquitination | Uniprot | |
| K141 | Ubiquitination | Uniprot | |
| Y156 | Phosphorylation | Uniprot | |
| T165 | Phosphorylation | Uniprot | |
| S166 | Phosphorylation | Uniprot | |
| K170 | Ubiquitination | Uniprot | |
| K171 | Ubiquitination | Uniprot | |
| K181 | Ubiquitination | Uniprot | |
| S196 | Phosphorylation | Uniprot |
Research Backgrounds
Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.
Nucleus.
Component of the GINS complex which is a heterotetramer of GINS1, GINS2, GINS3 and GINS4. Forms a stable subcomplex with GINS4. GINS complex interacts with DNA primase in vitro.
Belongs to the GINS1/PSF1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.