APOBEC3H Antibody - #DF9445
| Product: | APOBEC3H Antibody |
| Catalog: | DF9445 |
| Description: | Rabbit polyclonal antibody to APOBEC3H |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | Q6NTF7 |
| RRID: | AB_2842641 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9445, RRID:AB_2842641.
Fold/Unfold
A3H; APOBEC related protein 10; APOBEC3H; Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3H; ARP 10; DNA dC->dU-editing enzyme APOBEC-3H;
Immunogens
Expressed in lymphoid organs. Also detected in non-lymphoid tissues including lung, testis, ovary, fetal liver and skin.
- Q6NTF7 ABC3H_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV
PTMs - Q6NTF7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S170 | Phosphorylation | Uniprot |
Research Backgrounds
DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. The A3H-var/haplotype 2 exhibits antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Exhibits antiviral activity also against T-cell leukemia virus type 1 (HTLV-1) and may inhibit the mobility of LTR and non-LTR retrotransposons.
Nucleus. Cytoplasm. Cytoplasm>P-body.
Note: Haplotype 1 is distributed in both the nucleus and cytoplasm, whereas haplotype 2 is predominantly cytoplasmic.
Expressed in lymphoid organs. Also detected in non-lymphoid tissues including lung, testis, ovary, fetal liver and skin.
Interacts with AGO1, AGO2 and AGO3.
Belongs to the cytidine and deoxycytidylate deaminase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.