DHRS10 Antibody - #DF9435
Product: | DHRS10 Antibody |
Catalog: | DF9435 |
Description: | Rabbit polyclonal antibody to DHRS10 |
Application: | WB |
Reactivity: | Human, Mouse |
Mol.Wt.: | 28 kDa, 20 kDa; 28kD(Calculated). |
Uniprot: | Q9BPX1 |
RRID: | AB_2842631 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9435, RRID:AB_2842631.
Fold/Unfold
17 beta HSD 14; 17 beta hydroxysteroid dehydrogenase 14; 17 beta hydroxysteroid dehydrogenase DHRS10; Dehydrogenase/reductase (SDR family) member 10; Dehydrogenase/reductase SDR family member 10; DHRS10; Hydroxysteroid (17 beta) dehydrogenase 14; Retinal short chain dehydrogenase/reductase 3; Retinal short chain dehydrogenase/reductase retSDR3; retSDR3; SDR3; SDR47C1; Short chain dehydrogenase/reductase family 47C, member 1;
Immunogens
- Q9BPX1 DHB14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
PTMs - Q9BPX1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y7 | Phosphorylation | Uniprot | |
T15 | Phosphorylation | Uniprot | |
T71 | Phosphorylation | Uniprot |
Research Backgrounds
Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro).
Cytoplasm.
Highly expressed in brain, placenta, liver and kidney.
Homotetramer.
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.