CST6 Antibody - #DF9426
Product: | CST6 Antibody |
Catalog: | DF9426 |
Description: | Rabbit polyclonal antibody to CST6 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Mol.Wt.: | 17 kDa; 17kD(Calculated). |
Uniprot: | Q15828 |
RRID: | AB_2842622 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9426, RRID:AB_2842622.
Fold/Unfold
CST 6; CST6; Cystatin 6; Cystatin E; Cystatin E/M; Cystatin M; Cystatin M/E; Cystatin-6; Cystatin-E; Cystatin-M; Cystatin6; CystatinE; CystatinM; Cysteine proteinase inhibitor; CYTM_HUMAN;
Immunogens
Restricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity.
- Q15828 CYTM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
PTMs - Q15828 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S4 | Phosphorylation | Uniprot |
Research Backgrounds
Shows moderate inhibition of cathepsin B but is not active against cathepsin C.
Substrate for transglutaminases. Acts as an acyl acceptor but not as an acyl donor.
Secreted.
Restricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity.
Belongs to the cystatin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.