CST7 Antibody - #DF9425
Product: | CST7 Antibody |
Catalog: | DF9425 |
Description: | Rabbit polyclonal antibody to CST7 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 16~25 kDa; 16kD(Calculated). |
Uniprot: | O76096 |
RRID: | AB_2842621 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9425, RRID:AB_2842621.
Fold/Unfold
CMAP; CST 7; Cst7; Cystatin 7; cystatin F (leukocystatin); Cystatin like metastasis associated protein; Cystatin-7; Cystatin-F; Cystatin-like metastasis-associated protein; Cystatin7; CystatinF; CYTF_HUMAN; dJ568C11.1; Leukocystatin;
Immunogens
- O76096 CYTF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
PTMs - O76096 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T44 | Phosphorylation | Uniprot | |
N62 | N-Glycosylation | Uniprot | |
T76 | Phosphorylation | Uniprot | |
Y88 | Phosphorylation | Uniprot | |
T97 | Phosphorylation | Uniprot | |
T98 | Phosphorylation | Uniprot | |
N115 | N-Glycosylation | Uniprot |
Research Backgrounds
Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
Secreted. Cytoplasm.
Primarily expressed in peripheral blood cells and spleen.
Homodimer; disulfide-linked.
Belongs to the cystatin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.