C1QL4 Antibody - #DF9409
| Product: | C1QL4 Antibody |
| Catalog: | DF9409 |
| Description: | Rabbit polyclonal antibody to C1QL4 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 25 kDa; 25kD(Calculated). |
| Uniprot: | Q86Z23 |
| RRID: | AB_2842605 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9409, RRID:AB_2842605.
Fold/Unfold
C1QL4; C1QL4_HUMAN; Complement C1q-like protein 4;
Immunogens
Highest expression levels in testis and adipose tissue, lower levels in skeletal muscle and kidney.
- Q86Z23 C1QL4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVLLLLVAIPLLVHSSRGPAHYEMLGRCRMVCDPHGPRGPGPDGAPASVPPFPPGAKGEVGRRGKAGLRGPPGPPGPRGPPGEPGRPGPPGPPGPGPGGVAPAAGYVPRIAFYAGLRRPHEGYEVLRFDDVVTNVGNAYEAASGKFTCPMPGVYFFAYHVLMRGGDGTSMWADLMKNGQVRASAIAQDADQNYDYASNSVILHLDVGDEVFIKLDGGKVHGGNTNKYSTFSGFIIYPD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q86Z23 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S15 | Phosphorylation | Uniprot | |
| S16 | Phosphorylation | Uniprot | |
| K226 | Ubiquitination | Uniprot |
Research Backgrounds
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). May inhibit adipocyte differentiation at an early stage of the process (By similarity).
Secreted.
Highest expression levels in testis and adipose tissue, lower levels in skeletal muscle and kidney.
Forms homooligomers, predominantly dimers or trimers. Forms heterooligomers with C1QL1, C1QL2 and C1QL3, when proteins are coexpressed; this interaction does not occur after secretion. Interacts with ADGRB3.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.