C1QL3 Antibody - #DF9408
| Product: | C1QL3 Antibody |
| Catalog: | DF9408 |
| Description: | Rabbit polyclonal antibody to C1QL3 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Rabbit, Chicken |
| Mol.Wt.: | 27 kDa; 27kD(Calculated). |
| Uniprot: | Q5VWW1 |
| RRID: | AB_2842604 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9408, RRID:AB_2842604.
Fold/Unfold
C1q and tumor necrosis factor-related protein 13; C1q/TNF-related protein 13; C1ql; C1QL3; C1QL3_HUMAN; C1QTNF13; Complement C1q-like protein 3; Complement component 1, q subcomponent-like 3; CTRP13; K100;
Immunogens
Highly expressed in adipose tissue, with expression levels at least 2 orders of magnitude higher than in other tissues, including brain and kidney.
- Q5VWW1 C1QL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q5VWW1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y35 | Phosphorylation | Uniprot | |
| Y140 | Phosphorylation | Uniprot |
Research Backgrounds
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production (By similarity).
Secreted.
Highly expressed in adipose tissue, with expression levels at least 2 orders of magnitude higher than in other tissues, including brain and kidney.
Forms homooligomers. Interacts with ADGRB3. Interacts with C1QL2 and C1QL4, when proteins are coexpressed; this interaction does not occur after secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.