C1QTNF8 Antibody - #DF9406
Product: | C1QTNF8 Antibody |
Catalog: | DF9406 |
Description: | Rabbit polyclonal antibody to C1QTNF8 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse |
Mol.Wt.: | 28 kDa; 28kD(Calculated). |
Uniprot: | P60827 |
RRID: | AB_2842602 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9406, RRID:AB_2842602.
Fold/Unfold
C1q and tumor necrosis factor related protein 8; C1q/TNF-related protein 8; C1QT8_HUMAN; C1QTNF8; Complement C1q tumor necrosis factor-related protein 8; CTRP8; UNQ5829; UNQ5829/PRO19648;
Immunogens
Expressed predominantly in lung and testis (PubMed:19666007). Expressed in astrocytes (PubMed:24014093).
- P60827 C1QT8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSGHLVKPAAEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P60827 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S84 | Phosphorylation | Uniprot |
Research Backgrounds
May play a role as ligand of RXFP1.
Not N-glycosylated.
Secreted.
Expressed predominantly in lung and testis. Expressed in astrocytes.
Homotrimer. Forms heteromeric complexes with C1QL1. Interacts with RXFP1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.