CEP41 Antibody - #DF9362
| Product: | CEP41 Antibody |
| Catalog: | DF9362 |
| Description: | Rabbit polyclonal antibody to CEP41 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 41 kDa; 41kD(Calculated). |
| Uniprot: | Q9BYV8 |
| RRID: | AB_2842558 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9362, RRID:AB_2842558.
Fold/Unfold
centrosomal protein 41 kDa; Centrosomal protein of 41 kDa; CEP 41; Cep41; CEP41_HUMAN; testis specific 14; testis specific gene A14; Testis specific gene A14 protein; testis specific protein A14; Testis-specific gene A14 protein;
Immunogens
- Q9BYV8 CEP41_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLRRHIGNPEYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAASDPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLITGSLPASCQQALPPGSARKRSSPKGPPLPAENKWRFTPEDLKKIEYYLEEEQGPADHPSRLNQANSSGRESKVPGARSAQNLPGGGPASHSNPRSLSSGHLQGKPWK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BYV8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y12 | Phosphorylation | Uniprot | |
| S35 | Phosphorylation | Uniprot | |
| S96 | Phosphorylation | Uniprot | |
| S99 | Phosphorylation | Uniprot | |
| S119 | Phosphorylation | Uniprot | |
| S121 | Phosphorylation | Uniprot | |
| S282 | Phosphorylation | Uniprot | |
| S287 | Phosphorylation | Uniprot | |
| S288 | Phosphorylation | Uniprot | |
| Y312 | Phosphorylation | Uniprot | |
| S344 | Phosphorylation | Uniprot | |
| S363 | Phosphorylation | Uniprot | |
| K370 | Acetylation | Uniprot |
Research Backgrounds
Required during ciliogenesis for tubulin glutamylation in cilium. Probably acts by participating in the transport of TTLL6, a tubulin polyglutamylase, between the basal body and the cilium.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cell projection>Cilium. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: Localizes mainly to the cilium basal body and in primary cilia.
Isoform 1 and isoform 4 are expressed in testis and fetal tissues.
Found in a complex with TTLL6.
Although it contains a rhodanese domain, does not display phosphatase activity, suggesting that the protein is enzymatically inactive.
Belongs to the CEP41 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.