BORG5 Antibody - #DF9356
Product: | BORG5 Antibody |
Catalog: | DF9356 |
Description: | Rabbit polyclonal antibody to BORG5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 40~50 kDa; 40kD(Calculated). |
Uniprot: | Q00587 |
RRID: | AB_2842552 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9356, RRID:AB_2842552.
Fold/Unfold
55 kDa bone marrow stromal/endothelial cell protein; Binder of Rho GTPases 5; Bone marrow stromal/endothelial cell protein, 55-KD; BORG 5; BORG5; BORG5_HUMAN; CDC42 effector protein (Rho GTPase binding) 1; Cdc42 effector protein 1; Cdc42ep1; CEP 1; CEP1; MGC15316; MSE 55; MSE55; OTTHUMP00000028709; Serum constituent protein; Serum protein MSE55;
Immunogens
- Q00587 BORG5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q00587 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
R8 | Methylation | Uniprot | |
S14 | Phosphorylation | Uniprot | |
K17 | Methylation | Uniprot | |
S19 | Phosphorylation | Uniprot | |
S26 | Phosphorylation | Uniprot | |
S27 | Phosphorylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
T34 | Phosphorylation | Uniprot | |
R53 | Methylation | Uniprot | |
T61 | Phosphorylation | Uniprot | |
S62 | Phosphorylation | Uniprot | |
S65 | Phosphorylation | Uniprot | |
S70 | Phosphorylation | Uniprot | |
S71 | Phosphorylation | Uniprot | |
S73 | Phosphorylation | Uniprot | |
T74 | Phosphorylation | Uniprot | |
R76 | Methylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
R79 | Methylation | Uniprot | |
S80 | Phosphorylation | Uniprot | |
R98 | Methylation | Uniprot | |
S101 | Phosphorylation | Uniprot | |
S106 | Phosphorylation | Uniprot | |
S113 | Phosphorylation | P28482 (MAPK1) | Uniprot |
K117 | Ubiquitination | Uniprot | |
S121 | Phosphorylation | Uniprot | |
Y130 | Phosphorylation | Uniprot | |
S132 | Phosphorylation | Uniprot | |
S142 | Phosphorylation | Uniprot | |
S143 | Phosphorylation | Uniprot | |
T145 | Phosphorylation | Uniprot | |
S146 | Phosphorylation | Uniprot | |
S147 | Phosphorylation | Uniprot | |
T148 | Phosphorylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
Y154 | Phosphorylation | Uniprot | |
S180 | Phosphorylation | Uniprot | |
S183 | Phosphorylation | Uniprot | |
S190 | Phosphorylation | Uniprot | |
S192 | Phosphorylation | Uniprot | |
S195 | Phosphorylation | P28482 (MAPK1) | Uniprot |
S302 | Phosphorylation | Uniprot | |
S303 | Phosphorylation | Uniprot | |
R310 | Methylation | Uniprot | |
Y331 | Phosphorylation | Uniprot | |
S350 | Phosphorylation | Uniprot | |
S353 | Phosphorylation | Uniprot | |
S365 | Phosphorylation | Uniprot | |
T367 | Phosphorylation | Uniprot |
Research Backgrounds
Probably involved in the organization of the actin cytoskeleton. Induced membrane extensions in fibroblasts.
Endomembrane system>Peripheral membrane protein. Cytoplasm>Cytoskeleton.
Endothelial and bone marrow stromal cells.
Interacts with RHOQ and CDC42, in a GTP-dependent manner.
The CRIB domain mediates interaction with CDC42.
Belongs to the BORG/CEP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.