CHAC1 Antibody - #DF9353
Product: | CHAC1 Antibody |
Catalog: | DF9353 |
Description: | Rabbit polyclonal antibody to CHAC1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 29kDa; 24kD(Calculated). |
Uniprot: | Q9BUX1 |
RRID: | AB_2842549 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9353, RRID:AB_2842549.
Fold/Unfold
Blocks Notch protein; Botch; Cation transport regulator like protein 1; Cation transport regulator-like protein 1; ChaC; ChaC cation transport regulator homolog 1; ChaC cation transport regulator like 1; chac1; CHAC1_HUMAN; Gamma GCT acting on glutathione homolog 1; Gamma-GCG 1; Glutathione-specific gamma-glutamylcyclotransferase 1;
Immunogens
- Q9BUX1 CHAC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BUX1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S61 | Phosphorylation | Uniprot | |
T92 | Phosphorylation | Uniprot | |
K109 | Sumoylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
K124 | Ubiquitination | Uniprot | |
S172 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides. Glutathione depletion is an important factor for apoptosis initiation and execution. Acts as a pro-apoptotic component of the unfolded protein response pathway by mediating the pro-apoptotic effects of the ATF4-ATF3-DDIT3/CHOP cascade. Negative regulator of Notch signaling pathway involved in embryonic neurogenesis: acts by inhibiting Notch cleavage by furin, maintaining Notch in an immature inactive form, thereby promoting neurogenesis in embryos.
Cytoplasm>Cytosol. Golgi apparatus>trans-Golgi network.
Interacts with NOTCH1 (via extracellular region).
Belongs to the gamma-glutamylcyclotransferase family. ChaC subfamily.
References
Application: WB Species: Mice Sample: GC cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.