ARPP19 Antibody - #DF9325
| Product: | ARPP19 Antibody |
| Catalog: | DF9325 |
| Description: | Rabbit polyclonal antibody to ARPP19 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog, Chicken |
| Mol.Wt.: | 12 kDa; 12kD(Calculated). |
| Uniprot: | P56211 |
| RRID: | AB_2842521 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9325, RRID:AB_2842521.
Fold/Unfold
ARP19_HUMAN; ARPP-19; Arpp19; cAMP-regulated phosphoprotein 19;
Immunogens
- P56211 ARP19_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P56211 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| S2 | Phosphorylation | Uniprot | |
| S10 | Phosphorylation | Uniprot | |
| T22 | Phosphorylation | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| K26 | Acetylation | Uniprot | |
| K31 | Acetylation | Uniprot | |
| K33 | Acetylation | Uniprot | |
| R35 | Methylation | Uniprot | |
| Y36 | Phosphorylation | Uniprot | |
| K42 | Acetylation | Uniprot | |
| K42 | Ubiquitination | Uniprot | |
| S46 | Phosphorylation | Uniprot | |
| K58 | Acetylation | Uniprot | |
| K58 | Ubiquitination | Uniprot | |
| Y59 | Phosphorylation | Uniprot | |
| S62 | Phosphorylation | Uniprot | |
| Y65 | Phosphorylation | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K71 | Ubiquitination | Uniprot | |
| T79 | Phosphorylation | Uniprot | |
| K84 | Acetylation | Uniprot | |
| T94 | Phosphorylation | Uniprot | |
| K102 | Ubiquitination | Uniprot | |
| S104 | Phosphorylation | P17612 (PRKACA) | Uniprot |
| S108 | Phosphorylation | Uniprot | |
| K109 | Acetylation | Uniprot |
Research Backgrounds
Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-62 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase. May indirectly enhance GAP-43 expression.
Phosphorylation at Ser-62 by GWL during mitosis is essential for interaction with PPP2R2D (PR55-delta) and subsequent inactivation of PP2A (By similarity). Phosphorylated by PKA.
Cytoplasm.
Interacts (when phosphorylated at Ser-62) with PPP2R2D (By similarity). Interacts with SNCA.
Belongs to the endosulfine family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.