Phospho-c-Jun (Ser73) Antibody - AF3095
-
- Product Name
- Phospho-c-Jun (Ser73) Antibody
-
- Catalog No.
- AF3095
-
- RRID
- AB_2834532
-
- Source
- Rabbit
-
- Application
- WB,IHC,IF/ICC,ELISA
-
- Reactivity
- Human, Mouse, Rat, Zebrafish
-
- Prediction
- Pig(100%), Bovine(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
-
- UniProt
-
- Mol.Wt
- (Observed)37kD; (Calculated)36kDa,35kDa
-
- Concentration
- 1mg/ml
Related Products
Product Information
Alternative Names:Expand▼
Activator protein 1; AP 1; AP1; cJun; Enhancer Binding Protein AP1; Jun Activation Domain Binding Protein; JUN; Jun oncogene; JUN protein; Jun proto oncogene; JUN_HUMAN; JUNC; Oncogene JUN; p39; Proto oncogene c jun; Proto oncogene cJun; Proto-oncogene c-jun; Transcription Factor AP 1; Transcription factor AP-1; Transcription Factor AP1; V jun avian sarcoma virus 17 oncogene homolog; V jun sarcoma virus 17 oncogene homolog (avian); V jun sarcoma virus 17 oncogene homolog; V-jun avian sarcoma virus 17 oncogene homolog; vJun Avian Sarcoma Virus 17 Oncogene Homolog; Activator protein 1; AP 1; AP1; Jun D; jun D proto oncogene; Jund; JunD FL isoform; JUND_HUMAN; Transcription factor jun D; Transcription factor jun-D;
Applications:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
Reactivity:
Human, Mouse, Rat, Zebrafish
Predicted Reactivity:
Pig(100%), Bovine(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Source:
Rabbit
Clonality:
Polyclonal
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Specificity:
Phospho-c-Jun (Ser73) Antibody detects endogenous levels of c-Jun only when phosphorylated at Serine 73.
RRID:
AB_2834532
Please cite this product as: Affinity Biosciences Cat# AF3095, RRID:AB_2834532.
Format:
Liquid
Concentration:
1mg/ml
Storage Condition and Buffer:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.
Immunogen Information
Immunogen:
A synthesized peptide derived from human c-Jun around the phosphorylation site of Ser73.
Uniprot:
>>Visit The Human Protein Atlas
Gene ID:
Gene Name:
JUN,JUND
Molecular Weight:
Observed Mol.Wt.: (Observed)37kD.
Predicted Mol.Wt.: (Calculated)36kDa,35kDa.
Subcellular Location:
Nucleus.
Tissue Specificity:
P05412 JUN_HUMAN:
Expressed in the developing and adult prostate and prostate cancer cells.
Description:
JunD Transcription factor binding AP-1 sites. Binds DNA as a dimer. Interacts with MEN1; this interaction represses transcriptional activation.
Sequence:
- P05412 JUN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
- P17535 JUND_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
Research Background
Function:
Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3' (PubMed:10995748, PubMed:22083952). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed:17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306).
Post-translational Modifications:
Ubiquitinated by the SCF(FBXW7), leading to its degradation (PubMed:14739463, PubMed:27458189). Ubiquitination takes place following phosphorylation, that promotes interaction with FBXW7 (PubMed:14739463).
Phosphorylated by CaMK4 and PRKDC; phosphorylation enhances the transcriptional activity. Phosphorylated by HIPK3. Phosphorylated by DYRK2 at Ser-243; this primes the protein for subsequent phosphorylation by GSK3B at Thr-239. Phosphorylated at Thr-239, Ser-243 and Ser-249 by GSK3B; phosphorylation reduces its ability to bind DNA. Phosphorylated by PAK2 at Thr-2, Thr-8, Thr-89, Thr-93 and Thr-286 thereby promoting JUN-mediated cell proliferation and transformation. Phosphorylated by PLK3 following hypoxia or UV irradiation, leading to increase DNA-binding activity.
Acetylated at Lys-271 by EP300.
Subcellular Location:
Nucleus.
Tissue Specificity:
Expressed in the developing and adult prostate and prostate cancer cells.
Subunit Structure:
Heterodimer with either FOS or BATF3 or ATF7 (PubMed:10376527, PubMed:12087103, PubMed:15467742). The ATF7/JUN heterodimer is essential for ATF7 transactivation activity (PubMed:10376527). Interacts with DSIPI; the interaction inhibits the binding of active AP1 to its target DNA (By similarity). Interacts with HIVEP3 and MYBBP1A (By similarity). Interacts with SP1, SPIB and TCF20 (PubMed:10196196, PubMed:16478997, PubMed:8663478). Interacts with COPS5; the interaction leads indirectly to its phosphorylation (PubMed:8837781). Component of the SMAD3/SMAD4/JUN/FOS/complex which forms at the AP1 promoter site (PubMed:10995748). The SMAD3/SMAD4 heterodimer acts synergistically with the JUN/FOS heterodimer to activate transcription in response to TGF-beta (PubMed:9732876). Interacts (via its basic DNA binding and leucine zipper domains) with SMAD3 (via an N-terminal domain); the interaction is required for TGF-beta-mediated transactivation of the SMAD3/SMAD4/JUN/FOS/complex (PubMed:10995748). Interacts with methylated RNF187 (PubMed:20852630, PubMed:23624934). Binds to HIPK3. Interacts (when phosphorylated) with FBXW7 (PubMed:14739463). Found in a complex with PRR7 and FBXW7 (PubMed:27458189). Interacts with PRR7 and FBXW7; the interaction inhibits ubiquitination-mediated JUN degradation promoting its phosphorylation and transcriptional activity (PubMed:27458189). Interacts with RBM39 (By similarity). Interacts with PAGE4 (PubMed:24263171, PubMed:24559171, PubMed:26242913).
Similarity:
Belongs to the bZIP family. Jun subfamily.
Function:
Transcription factor binding AP-1 sites.
Post-translational Modifications:
Phosphorylated by MAP kinases MAPK8 and MAPK10; phosphorylation is inhibited in the presence of MEN1.
Subcellular Location:
Nucleus.
Subunit Structure:
Binds DNA as a dimer (By similarity). Interacts (via MBM motif) with MEN1; this interaction represses transcriptional activation (PubMed:9989505, PubMed:22327296). Interacts with MAPK10; this interaction is inhibited in the presence of MEN1 (PubMed:22327296).
Similarity:
Belongs to the bZIP family. Jun subfamily.
Research Fields
Research Fields:
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Tight junction.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > ErbB signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Wnt signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway.(View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Cancers: Specific types > Breast cancer.(View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Cancers: Overview > Choline metabolism in cancer.(View pathway)
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Bacterial > Epithelial cell signaling in Helicobacter pylori infection.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Substance dependence > Cocaine addiction.
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.(View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Immune system > Th17 cell differentiation.(View pathway)
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)
· Organismal Systems > Development > Osteoclast differentiation.(View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Immune system > NOD-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > B cell receptor signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Estrogen signaling pathway.(View pathway)
Protocols & Troubleshooting
WB Images(1)
IHC Images(7)
IF/ICC Images(1)
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.
Reference Citations:
Application: WB Species:human; Sample:SV-HUC-1 cells
Figure 4. (A) Fold change in cell viability of SV-HUC-1 cells treated with 0, 0.10 and 0.25% CSE for 7 days in combination with 5 µM U0126, 5 µM SB203580 or 2 µM SP600125. Data are representative of three independent experiments and are expressed as the mean ± standard deviation. * P
Submit Review
Catalog Number :
AF3095-BP
(Blocking peptide available as AF3095-BP)
Price/Size :
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide（0.5mg) and non-phospho peptide(0.5mg).
Function :
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Format and storage :
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
Precautions :
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
P05412/P17535 as Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T2 | Phosphorylation | Q13177 (PAK2) | Uniprot |
| T8 | Phosphorylation | Q13177 (PAK2) | Uniprot |
| Y26 | Phosphorylation | P41240 (CSK) | Uniprot |
| S37 | Phosphorylation | Uniprot | |
| S48 | Phosphorylation | Uniprot | |
| K50 | Acetylation | Uniprot | |
| K50 | Ubiquitination | Uniprot | |
| K56 | Sumoylation | Uniprot | |
| S58 | Phosphorylation | Uniprot | |
| T62 | Phosphorylation | Uniprot | |
| S63 | Phosphorylation | P45983 (MAPK8) , P45984 (MAPK9) , P06493 (CDK1) , Q15139 (PRKD1) , Q96KB5 (PBK) , Q8TD08 (MAPK15) , Q9H4B4 (PLK3) , P53779 (MAPK10) , Q00526 (CDK3) , P27361 (MAPK3) , Q99986 (VRK1) | Uniprot |
| K70 | Ubiquitination | Uniprot | |
| S73 | Phosphorylation | Q8TD08 (MAPK15) , P53779 (MAPK10) , Q99986 (VRK1) , P27361 (MAPK3) , P45983 (MAPK8) , Q96KB5 (PBK) , P06493 (CDK1) , Q9H4B4 (PLK3) , P45984 (MAPK9) , Q00526 (CDK3) | Uniprot |
| T89 | Phosphorylation | Q13177 (PAK2) | Uniprot |
| T91 | Phosphorylation | P45983 (MAPK8) | Uniprot |
| T93 | Phosphorylation | P45983 (MAPK8) , Q13177 (PAK2) | Uniprot |
| T95 | Phosphorylation | Uniprot | |
| T131 | Phosphorylation | Uniprot | |
| Y170 | Phosphorylation | P00519 (ABL1) , P41240 (CSK) | Uniprot |
| K226 | Sumoylation | Uniprot | |
| T231 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| T239 | Phosphorylation | P49840 (GSK3A) , P49841 (GSK3B) | Uniprot |
| S243 | Phosphorylation | P06493 (CDK1) , P49841 (GSK3B) , P68400 (CSNK2A1) , Q92630 (DYRK2) , P49840 (GSK3A) | Uniprot |
| S249 | Phosphorylation | P68400 (CSNK2A1) , P78527 (PRKDC) , P49840 (GSK3A) | Uniprot |
| K254 | Sumoylation | Uniprot | |
| K268 | Acetylation | Uniprot | |
| C269 | S-Nitrosylation | Uniprot | |
| K271 | Acetylation | Uniprot | |
| K273 | Acetylation | Uniprot | |
| T286 | Phosphorylation | Q13177 (PAK2) | Uniprot |
| K309 | Ubiquitination | Uniprot | |
| C320 | S-Nitrosylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S27 | Phosphorylation | Uniprot | |
| T38 | Phosphorylation | Uniprot | |
| S43 | Phosphorylation | Uniprot | |
| T71 | Phosphorylation | Uniprot | |
| S90 | Phosphorylation | P45983 (MAPK8) | Uniprot |
| K97 | Ubiquitination | Uniprot | |
| S100 | Phosphorylation | P45983 (MAPK8) , P27361 (MAPK3) , P28482 (MAPK1) | Uniprot |
| T117 | Phosphorylation | P45983 (MAPK8) | Uniprot |
| K127 | Ubiquitination | Uniprot | |
| S131 | Phosphorylation | Uniprot | |
| K142 | Ubiquitination | Uniprot | |
| K240 | Sumoylation | Uniprot | |
| T245 | Phosphorylation | Uniprot | |
| S251 | Phosphorylation | Uniprot | |
| S255 | Phosphorylation | Uniprot | |
| S259 | Phosphorylation | Uniprot | |
| T265 | Phosphorylation | Uniprot | |
| S294 | Phosphorylation | Uniprot | |
| S305 | Phosphorylation | Uniprot | |
| T308 | Phosphorylation | Uniprot | |
| S312 | Phosphorylation | Uniprot | |
| T313 | Phosphorylation | Uniprot | |
| S315 | Phosphorylation | Uniprot | |
| K325 | Ubiquitination | Uniprot | |
| K327 | Ubiquitination | Uniprot |
To Top