SLC25A13 Antibody - #DF9303
| Product: | SLC25A13 Antibody |
| Catalog: | DF9303 |
| Description: | Rabbit polyclonal antibody to SLC25A13 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 74 kDa; 74kD(Calculated). |
| Uniprot: | Q9UJS0 |
| RRID: | AB_2842499 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9303, RRID:AB_2842499.
Fold/Unfold
AI785475; ARALAR2; Calcium binding mitochondrial carrier protein Aralar2; Calcium-binding mitochondrial carrier protein Aralar2; Citrin; CMC2_HUMAN; CTLN2; Ctrn; Mitochondrial aspartate glutamate carrier 2; RGD1565889; Slc25a13; Solute carrier family 25 (citrin) member 13; Solute carrier family 25 member 13 (citrin); Solute carrier family 25 member 13;
Immunogens
High levels in liver and low levels in kidney, pancreas, placenta, heart and brain.
- Q9UJS0 CMC2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTLAGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGTLPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UJS0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| T9 | Phosphorylation | Uniprot | |
| K23 | Acetylation | Uniprot | |
| K23 | Ubiquitination | Uniprot | |
| S51 | Phosphorylation | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| S218 | Phosphorylation | Uniprot | |
| Y219 | Phosphorylation | Uniprot | |
| T250 | Phosphorylation | Uniprot | |
| K251 | Ubiquitination | Uniprot | |
| K353 | Ubiquitination | Uniprot | |
| K379 | Acetylation | Uniprot | |
| K379 | Methylation | Uniprot | |
| K405 | Acetylation | Uniprot | |
| K408 | Ubiquitination | Uniprot | |
| K453 | Methylation | Uniprot | |
| K484 | Acetylation | Uniprot | |
| K484 | Methylation | Uniprot | |
| K484 | Ubiquitination | Uniprot | |
| K487 | Ubiquitination | Uniprot | |
| S619 | Phosphorylation | Uniprot | |
| Y657 | Phosphorylation | Uniprot | |
| S664 | Phosphorylation | Uniprot | |
| S666 | Phosphorylation | Uniprot | |
| T667 | Phosphorylation | Uniprot |
Research Backgrounds
Mitochondrial and calcium-binding carrier that catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.
Mitochondrion inner membrane>Multi-pass membrane protein.
High levels in liver and low levels in kidney, pancreas, placenta, heart and brain.
Homodimer (via N-terminus).
Upon calcium binding, the EF-hand-containing regulatory N-terminal domain binds to the C-terminal domain, opening a vestibule which allows the substrates to be translocated through the carrier domain (PubMed:25410934). In the absence of calcium, the helix loop domain may close the vestibule, which may prevent substrates from entering the carrier domain (By similarity).
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.