BCAS3 Antibody - #DF9291
Product: | BCAS3 Antibody |
Catalog: | DF9291 |
Description: | Rabbit polyclonal antibody to BCAS3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 101 kDa; 101kD(Calculated). |
Uniprot: | Q9H6U6 |
RRID: | AB_2842487 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9291, RRID:AB_2842487.
Fold/Unfold
1500019F07Rik; 2610028P08Rik; AU021018; BC028339; BCAS3; BCAS3_HUMAN; Breast carcinoma-amplified sequence 3; FLJ20128; GAOB1; K20D4; MAAB; Maab1 protein; MGC4973; rudhira;
Immunogens
Expressed in stomach, liver, lung, kidney, prostate, testis, thyroid gland, adrenal gland, brain, heart, skeletal muscle, colon, spleen, small intestine, placenta, blood leukocyte and mammary epithelial cells. Expressed in undifferentiated ES cells. Expressed in blood islands and nascent blood vessels derived from differentiated ES cells into embryoid bodies (BD). Expressed in endothelial cells. Not detected in brain. Expressed in brain tumors (at protein level). Expressed in brain. Highly expressed in breast cancers and in glioma cell lines.
- Q9H6U6 BCAS3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPPLLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLYSLRTGEMVKSIQFKTPIYDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCYPCPGPNMNPIALGSRWLAYAENKLIRCHQSRGGACGDNIQSYTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPYGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSYNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPYLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCYGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H6U6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T73 | Phosphorylation | Uniprot | |
K145 | Ubiquitination | Uniprot | |
S180 | Phosphorylation | Uniprot | |
K184 | Ubiquitination | Uniprot | |
K215 | Sumoylation | Uniprot | |
K215 | Ubiquitination | Uniprot | |
K246 | Acetylation | Uniprot | |
T275 | Phosphorylation | Uniprot | |
T288 | Phosphorylation | Uniprot | |
S456 | Phosphorylation | Uniprot | |
S461 | Phosphorylation | Uniprot | |
K474 | Ubiquitination | Uniprot | |
S480 | Phosphorylation | Uniprot | |
S486 | Phosphorylation | Uniprot | |
S487 | Phosphorylation | Uniprot | |
S488 | Phosphorylation | Uniprot | |
S490 | Phosphorylation | Uniprot | |
S503 | Phosphorylation | Uniprot | |
S518 | Phosphorylation | Uniprot | |
S570 | Phosphorylation | Uniprot | |
S574 | Phosphorylation | Uniprot | |
S617 | Phosphorylation | Uniprot | |
T648 | Phosphorylation | Uniprot | |
S649 | Phosphorylation | Uniprot | |
S706 | Phosphorylation | Uniprot | |
S709 | Phosphorylation | Uniprot | |
S801 | Phosphorylation | Uniprot | |
S823 | Phosphorylation | Uniprot | |
S838 | Phosphorylation | Uniprot | |
S850 | Phosphorylation | Uniprot | |
S869 | Phosphorylation | Uniprot | |
S871 | Phosphorylation | Uniprot | |
S877 | Phosphorylation | Uniprot | |
S886 | Phosphorylation | Uniprot | |
S891 | Phosphorylation | Uniprot | |
S893 | Phosphorylation | Uniprot | |
S894 | Phosphorylation | Uniprot | |
T897 | Phosphorylation | Uniprot | |
S900 | Phosphorylation | Uniprot | |
Y908 | Phosphorylation | Uniprot | |
S910 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in angiogenesis. Participates in the regulation of cell polarity and directional endothelial cell migration by mediating both the activation and recruitment of CDC42 and the reorganization of the actin cytoskeleton at the cell leading edge. Promotes filipodia formation (By similarity). Functions synergistically with PELP1 as a transcriptional coactivator of estrogen receptor-responsive genes. Stimulates histone acetyltransferase activity. Binds to chromatin.
Nucleus. Cytoplasm. Cytoplasm>Cytoskeleton.
Note: Localizes in the cytoplasm in stationary cells. Translocates from the cytoplasm to the leading edge in motile cells. Colocalizes with microtubules and intermediate filaments in both stationary and motile cells (By similarity). Associates with chromatin. Recruited to estrogen receptor-induced promoters in a PELP1-dependent manner.
Expressed in stomach, liver, lung, kidney, prostate, testis, thyroid gland, adrenal gland, brain, heart, skeletal muscle, colon, spleen, small intestine, placenta, blood leukocyte and mammary epithelial cells. Expressed in undifferentiated ES cells. Expressed in blood islands and nascent blood vessels derived from differentiated ES cells into embryoid bodies (BD). Expressed in endothelial cells. Not detected in brain. Expressed in brain tumors (at protein level). Expressed in brain. Highly expressed in breast cancers and in glioma cell lines.
Interacts with histone H3, ESR1, KAT2B and PELP1; the interactions occur in a estrogen-dependent manner. Interacts with beta-tubulin and VIM.
Has been proposed to contain 7 WD repeats. This prediction could not be reproduced.
Belongs to the BCAS3 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.