PCP4 Antibody - #DF9286
Product: | PCP4 Antibody |
Catalog: | DF9286 |
Description: | Rabbit polyclonal antibody to PCP4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 7 kDa; 7kD(Calculated). |
Uniprot: | P48539 |
RRID: | AB_2842482 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9286, RRID:AB_2842482.
Fold/Unfold
Brain specific antigen PCP 4; Brain specific polypeptide PEP 19; Brain specific polypeptide PEP19; Brain-specific antigen PCP-4; Brain-specific polypeptide PEP-19; OTTHUMP00000109191; Pcp4; PCP4_HUMAN; PEP19; Purkinje cell protein 4;
Immunogens
- P48539 PCP4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P48539 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot |
Research Backgrounds
Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls. For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways.
Binds to both calcium-free and calcium-bound calmodulin. The affinity for the calcium-bound form is 50-fold greater.
Mostly intrinsically disordered, with residual structure localized to the IQ domain which mediates the interaction with calmodulin.
Belongs to the PCP4 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.