SLC25A14 Antibody - #DF9283
| Product: | SLC25A14 Antibody |
| Catalog: | DF9283 |
| Description: | Rabbit polyclonal antibody to SLC25A14 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 36 kDa; 36kD(Calculated). |
| Uniprot: | O95258 |
| RRID: | AB_2842479 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9283, RRID:AB_2842479.
Fold/Unfold
BMCP1; Brain mitochondrial carrier protein 1; Mitochondrial Uncoupling Protein 5; Solute Carrier Family 25 Member 14;
Immunogens
- O95258 UCP5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95258 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T162 | Phosphorylation | Uniprot | |
| T279 | Phosphorylation | Uniprot |
Research Backgrounds
Participates in the mitochondrial proton leak measured in brain mitochondria.
Mitochondrion inner membrane>Multi-pass membrane protein.
Mainly expressed in brain. Some expression in testis and pituitary.
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.