CEL Antibody - #DF9279
Product: | CEL Antibody |
Catalog: | DF9279 |
Description: | Rabbit polyclonal antibody to CEL |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 79 kDa; 79kD(Calculated). |
Uniprot: | P19835 |
RRID: | AB_2842475 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9279, RRID:AB_2842475.
Fold/Unfold
BAL; Bile salt-stimulated lipase; BSDL; BSSL; Bucelipase; Carboxyl ester lipase (bile salt stimulated lipase); Carboxyl ester lipase; CEase; CEL; CELL; Cholesterol esterase; FAP; FAPP; Fetoacinar pancreatic protein; LIPA; Lysophospholipase, pancreatic; MODY8; Pancreatic lysophospholipase; Sterol esterase;
Immunogens
Mammary gland and pancreas. Detected in pancreatic and duodenal juice (at protein level) (PubMed:21784842). Expressed by eosinophils.
- P19835 CEL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGLEYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF
PTMs - P19835 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y27 | Phosphorylation | Uniprot | |
T28 | Phosphorylation | Uniprot | |
S238 | Phosphorylation | Uniprot | |
S245 | Phosphorylation | Uniprot | |
Y365 | Phosphorylation | Uniprot | |
T494 | Phosphorylation | Uniprot | |
T558 | O-Glycosylation | Uniprot | |
T569 | O-Glycosylation | Uniprot | |
T579 | O-Glycosylation | Uniprot | |
T607 | O-Glycosylation | Uniprot | |
T618 | O-Glycosylation | Uniprot | |
T629 | O-Glycosylation | Uniprot | |
T640 | O-Glycosylation | Uniprot | |
T651 | O-Glycosylation | Uniprot | |
T662 | O-Glycosylation | Uniprot | |
T673 | O-Glycosylation | Uniprot |
Research Backgrounds
Catalyzes the hydrolysis of a wide range of substrates including cholesteryl esters, phospholipids, lysophospholipids, di- and tri-acylglycerols, and fatty acid esters of hydroxy fatty acids (FAHFAs). Preferentially hydrolyzes FAHFAs with the ester bond further away from the carboxylate. Unsaturated FAHFAs are hydrolyzed more quickly than saturated FAHFAs (By similarity). Has an essential role in the complete digestion of dietary lipids and their intestinal absorption, along with the absorption of fat-soluble vitamins.
N- and O-glycosylated.
Secreted.
Mammary gland and pancreas. Detected in pancreatic and duodenal juice (at protein level). Expressed by eosinophils.
Interacts with CLC.
Belongs to the type-B carboxylesterase/lipase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.