BATF2 Antibody - #DF9266
Product: | BATF2 Antibody |
Catalog: | DF9266 |
Description: | Rabbit polyclonal antibody to BATF2 |
Application: | WB |
Reactivity: | Human |
Prediction: | Pig, Horse, Sheep, Dog |
Mol.Wt.: | 29kDa; 29kD(Calculated). |
Uniprot: | Q8N1L9 |
RRID: | AB_2842462 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9266, RRID:AB_2842462.
Fold/Unfold
B ATF 2; Basic leucine zipper transcriptional factor ATF like 2; BATF2; MGC20410; SARI; Suppressor of AP 1 regulated by IFN;
Immunogens
- Q8N1L9 BATF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8N1L9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S227 | Phosphorylation | Uniprot |
Research Backgrounds
AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates in the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes (By similarity). Selectively suppresses CCN1 transcription and hence blocks the downstream cell proliferation signals produced by CCN1 and inhibits CCN1-induced anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma. Possibly acts by interfering with AP-1 binding to CCN1 promoter.
Nucleus.
Heterodimer; heterodimerizes with JUN family proteins.
Belongs to the bZIP family.
References
Application: WB Species: Human Sample: NCM460, LoVo and SW620 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.