Involucrin Antibody - #AF0186
Product: | Involucrin Antibody |
Catalog: | AF0186 |
Description: | Rabbit polyclonal antibody to Involucrin |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 68~120kDa; 68kD(Calculated). |
Uniprot: | P07476 |
RRID: | AB_2833379 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0186, RRID:AB_2833379.
Fold/Unfold
INVO_HUMAN; Involucrin; IVL;
Immunogens
- P07476 INVO_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK
PTMs - P07476 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S12 | Phosphorylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
T65 | Phosphorylation | Uniprot | |
K314 | Acetylation | Uniprot |
Research Backgrounds
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Substrate of transglutaminase. Some glutamines and lysines are cross-linked to other involucrin molecules, to other proteins such as keratin, desmoplakin, periplakin and envoplakin, and to lipids like omega-hydroxyceramide.
Cytoplasm.
Note: Constituent of the scaffolding of the cornified envelope.
Keratinocytes of epidermis and other stratified squamous epithelia.
Directly or indirectly cross-linked to cornifelin (CNFN).
Belongs to the involucrin family.
References
Application: IHC Species: Mouse Sample: mPEOs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.