Cathepsin H Antibody - #DF8514
| Product: | Cathepsin H Antibody |
| Catalog: | DF8514 |
| Description: | Rabbit polyclonal antibody to Cathepsin H |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 37kDa,25kDa; 37kD(Calculated). |
| Uniprot: | P09668 |
| RRID: | AB_2841719 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8514, RRID:AB_2841719.
Fold/Unfold
ACC 4; ACC 5; ACC4; ACC5; aleurain; CATH_HUMAN; cathepsin B3; cathepsin BA; Cathepsin H heavy chain; Cathepsin H light chain; Cathepsin H mini chain; CPSB; CTSH; minichain; N benzoylarginine beta naphthylamide hydrolase; N-benzoylarginine-beta-naphthylamide hydrolase; pro cathepsin H;
Immunogens
- P09668 CATH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P09668 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y94 | Phosphorylation | Uniprot | |
| N101 | N-Glycosylation | Uniprot | |
| S103 | Phosphorylation | Uniprot | |
| K106 | Ubiquitination | Uniprot | |
| C141 | S-Nitrosylation | Uniprot | |
| T204 | Phosphorylation | Uniprot | |
| Y205 | Phosphorylation | Uniprot | |
| N230 | N-Glycosylation | Uniprot |
Research Backgrounds
Important for the overall degradation of proteins in lysosomes.
Lysosome.
Composed of a mini chain and a large chain. The large chain may be split into heavy and light chain. All chains are held together by disulfide bonds.
Belongs to the peptidase C1 family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.