NEK6 Antibody - #DF8259
| Product: | NEK6 Antibody |
| Catalog: | DF8259 |
| Description: | Rabbit polyclonal antibody to NEK6 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 36 kDa; 36kD(Calculated). |
| Uniprot: | Q9HC98 |
| RRID: | AB_2841549 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8259, RRID:AB_2841549.
Fold/Unfold
Highly similar to cell cycle protein kinase CDC5/MSD2; NEK6; NEK6_HUMAN; Never in mitosis A-related kinase 6; NIMA (Never In Mitosis Gene A) Related Kinase 6; NimA related protein kinase 6; NimA-related protein kinase 6; Protein kinase SID6 1512; Protein kinase SID6-1512; Putative serine threonine protein kinase; Serine/threonine protein kinase Nek6; Serine/threonine-protein kinase Nek6; SID6 1512; SID61512;
Immunogens
- Q9HC98 NEK6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9HC98 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T35 | Phosphorylation | Uniprot | |
| S37 | Phosphorylation | Uniprot | |
| S41 | Phosphorylation | Uniprot | |
| K49 | Ubiquitination | Uniprot | |
| K61 | Ubiquitination | Uniprot | |
| K85 | Ubiquitination | Uniprot | |
| K92 | Ubiquitination | Uniprot | |
| K98 | Ubiquitination | Uniprot | |
| Y108 | Phosphorylation | Uniprot | |
| Y152 | Phosphorylation | Uniprot | |
| S158 | Phosphorylation | Uniprot | |
| S165 | Phosphorylation | Uniprot | |
| K174 | Ubiquitination | Uniprot | |
| T181 | Phosphorylation | Uniprot | |
| T183 | Phosphorylation | Uniprot | |
| K187 | Ubiquitination | Uniprot | |
| S199 | Phosphorylation | Uniprot | |
| T201 | Phosphorylation | Uniprot | |
| T202 | Phosphorylation | Uniprot | |
| S206 | Phosphorylation | Q8TD19 (NEK9) | Uniprot |
| T210 | Phosphorylation | Uniprot | |
| Y212 | Phosphorylation | Uniprot | |
| Y213 | Phosphorylation | Uniprot | |
| S215 | Phosphorylation | Uniprot | |
| K277 | Ubiquitination | Uniprot |
PTMs - Q9HC98 As Enzyme
| Substrate | Site | Source |
|---|---|---|
| O00141 (SGK1) | S377 | Uniprot |
| O00141-1 (SGK1) | S422 | Uniprot |
| P0DMV8 (HSPA1A) | T66 | Uniprot |
| P14859 (POU2F1) | S335 | Uniprot |
| P23443 (RPS6KB1) | S53 | Uniprot |
| P23443 (RPS6KB1) | S403 | Uniprot |
| P23443 (RPS6KB1) | T412 | Uniprot |
| P40763 (STAT3) | S727 | Uniprot |
| P50613 (CDK7) | S161 | Uniprot |
| P52732 (KIF11) | S1033 | Uniprot |
| P52948-2 (NUP98) | S591 | Uniprot |
| P52948 (NUP98) | S608 | Uniprot |
| P52948-2 (NUP98) | S822 | Uniprot |
| P52948 (NUP98) | S839 | Uniprot |
| Q05586 (GRIN1) | S890 | Uniprot |
| Q08345 (DDR1) | S788 | Uniprot |
| Q08999 (RBL2) | S659 | Uniprot |
Research Backgrounds
Protein kinase which plays an important role in mitotic cell cycle progression. Required for chromosome segregation at metaphase-anaphase transition, robust mitotic spindle formation and cytokinesis. Phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histones H1 and H3. Phosphorylates KIF11 to promote mitotic spindle formation. Involved in G2/M phase cell cycle arrest induced by DNA damage. Inhibition of activity results in apoptosis. May contribute to tumorigenesis by suppressing p53/TP53-induced cancer cell senescence.
Autophosphorylated. Phosphorylation at Ser-206 is required for its activation. Phosphorylated upon IR or UV-induced DNA damage. Phosphorylated by CHEK1 and CHEK2. Interaction with APBB1 down-regulates phosphorylation at Thr-210.
Cytoplasm. Nucleus. Nucleus speckle. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle pole.
Note: Colocalizes with APBB1 at the nuclear speckles. Colocalizes with PIN1 in the nucleus. Colocalizes with ATF4, CIR1, ARHGAP33, ANKRA2, CDC42, NEK9, RAD26L, RBBP6, RPS7, TRIP4, RELB and PHF1 in the centrosome. Localizes to spindle microtubules in metaphase and anaphase and to the midbody during cytokinesis.
Ubiquitous, with highest expression in heart and skeletal muscle.
Interacts with STAT3 and RPS6KB1 (By similarity). Interacts with NEK9, predominantly in mitosis. Interacts with KIF11 (via C-terminus). Interacts with APBB1 (via WW domain). Interacts with ANKRA2, ATF4, ARHGAP33, CDC42, CIR1, PRAM1, PTN, PRDX3, PIN1, RAD26L, RBBP6, RPS7 and TRIP4.
Displays an autoinhibited conformation: Tyr-108 side chain points into the active site, interacts with the activation loop, and blocks the alphaC helix. The autoinhibitory conformation is released upon binding with NEK9.
Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.