COX11 Antibody - #AF0601
Product: | COX11 Antibody |
Catalog: | AF0601 |
Description: | Rabbit polyclonal antibody to COX11 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse, Rabbit, Dog |
Mol.Wt.: | 31kDa; 31kD(Calculated). |
Uniprot: | Q9Y6N1 |
RRID: | AB_2834373 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0601, RRID:AB_2834373.
Fold/Unfold
COX11; COX11 homolog; COX11 homolog, cytochrome c oxidase assembly protein (yeast); COX11_HUMAN; COX11P; Cytochrome c oxidase assembly protein COX11; Cytochrome c oxidase assembly protein COX11, mitochondrial; Cytochrome c oxidase subunit 11; mitochondrial;
Immunogens
- Q9Y6N1 COX11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y6N1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S24 | Phosphorylation | Uniprot | |
K57 | Ubiquitination | Uniprot | |
Y117 | Phosphorylation | Uniprot | |
K138 | Ubiquitination | Uniprot | |
K146 | Ubiquitination | Uniprot | |
K188 | Ubiquitination | Uniprot | |
K193 | Ubiquitination | Uniprot | |
K265 | Ubiquitination | Uniprot | |
K269 | Ubiquitination | Uniprot |
Research Backgrounds
Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.
Mitochondrion inner membrane>Single-pass membrane protein>Intermembrane side.
Ubiquitous.
Interacts with CNNM4/ACDP4.
Belongs to the COX11/CtaG family.
Research Fields
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.