hCG beta Antibody - #AF0177
| Product: | hCG beta Antibody |
| Catalog: | AF0177 |
| Description: | Rabbit polyclonal antibody to hCG beta |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 20kDa; 18kD(Calculated). |
| Uniprot: | P0DN86 |
| RRID: | AB_2833370 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0177, RRID:AB_2833370.
Fold/Unfold
CG beta; CG-beta; CGB; CGB3; CGB5; CGB7; CGB8; CGHB_HUMAN; Choriogonadotropin subunit beta; Chorionic gonadotrophin chain beta; Chorionic gonadotropin beta 3 subunit; Chorionic gonadotropin beta polypeptide; Chorionic gonadotropin beta subunit; hCGB;
Immunogens
- P0DN86 CGB3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
PTMs - P0DN86 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S14 | Phosphorylation | Uniprot | |
| Y79 | Phosphorylation | Uniprot | |
| T117 | Phosphorylation | P17612 (PRKACA) | Uniprot |
| S141 | O-Glycosylation | Uniprot | |
| S147 | O-Glycosylation | Uniprot | |
| S147 | Phosphorylation | Uniprot | |
| S150 | Phosphorylation | Uniprot | |
| S152 | O-Glycosylation | Uniprot | |
| S152 | Phosphorylation | Uniprot | |
| S158 | O-Glycosylation | Uniprot |
Research Backgrounds
Beta subunit of the human chorionic gonadotropin (hCG). hCG is a complex glycoprotein composed of two glycosylated subunits alpha and beta which are non-covalently associated. The alpha subunit is identical to those in the pituitary gonadotropin hormones (LH, FSH and TSH). The beta subunits are distinct in each of the hormones and confer receptor and biological specificity. Has an essential role in pregnancy and maternal adaptation. Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
Secreted.
High expression in the placenta throughout pregnancy.
Heterodimer of a common alpha chain identical in LH, FSH, TSH and HCG and a unique beta chain distinct in each of the hormones.
Belongs to the glycoprotein hormones subunit beta family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.