MOBL3 Antibody - #AF0726
Product: | MOBL3 Antibody |
Catalog: | AF0726 |
Description: | Rabbit polyclonal antibody to MOBL3 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Chicken, Xenopus |
Mol.Wt.: | 26kDa; 26kD(Calculated). |
Uniprot: | Q9Y3A3 |
RRID: | AB_2834354 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0726, RRID:AB_2834354.
Fold/Unfold
2C4D; CGI 95; class II mMOB1; MGC12264; MOB family member 4, phocein; MOB like protein phocein; MOB1; mob1 homolog 3; MOB1, Mps One Binder kinase activator like 3; Mob3; MOB4; MOBKL3; MOBL3_HUMAN; mps one binder kinase activator like 3; Mps one binder kinase activator-like 3; Phocein Mob like protein; PHOCN; PREI3; Preimplantation protein 3; RCJMB04_1o21;
Immunogens
- Q9Y3A3 PHOCN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y3A3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
C134 | S-Nitrosylation | Uniprot | |
K140 | Acetylation | Uniprot | |
K140 | Ubiquitination | Uniprot | |
Y141 | Phosphorylation | Uniprot | |
S147 | Phosphorylation | Uniprot | |
K149 | Ubiquitination | Uniprot | |
K155 | Acetylation | Uniprot | |
T192 | Phosphorylation | Uniprot | |
Y198 | Phosphorylation | Uniprot |
Research Backgrounds
May play a role in membrane trafficking, specifically in membrane budding reactions.
Phosphorylated on serine residues.
Cytoplasm>Perinuclear region. Membrane>Peripheral membrane protein. Golgi apparatus>Golgi stack membrane>Peripheral membrane protein.
Note: In a perinuclear punctate pattern. Associated with membranes and the Golgi stacks.
Binds STRN4 (By similarity). Interacts with DNM1 and EPS15 (By similarity). Interacts with nucleoside diphosphate kinase (By similarity). Binds STRN and STRN3. Part of a ternary complex containing MOB4/PHOCN, STRN and/or STRN3 and PPA2. Interacts with CTTNBP2 (By similarity). Interacts with CTTNBP2NL.
Belongs to the MOB1/phocein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.