Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    C/EBP epsilon Antibody
  • Catalog No.
    AF0085
  • RRID
    AB_2833271
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human
  • Prediction
    Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
  • UniProt
  • Mol.Wt
    34kD;
    31kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

C/EBP epsilon; CCAAT/enhancer binding protein (C/EBP) epsilon; CCAAT/enhancer binding protein epsilon; CCAAT/enhancer-binding protein epsilon; CEBPE; CEBPE_HUMAN; CRP 1; CRP1;

Applications:

WB: 1:500-1:3000, IHC: 1:50-1:200, IF/ICC: 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human

Predicted Reactivity:

Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

C/EBP epsilon Antibody detects endogenous levels of total C/EBP epsilon.

RRID:

AB_2833271
Please cite this product as: Affinity Biosciences Cat# AF0085, RRID:AB_2833271.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human C/EBP epsilon, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

CEBPE

Molecular Weight:

Observed Mol.Wt.: 34kD.
Predicted Mol.Wt.: 31kDa(Calculated)..

Subcellular Location:

Nucleus.

Tissue Specificity:

Q15744 CEBPE_HUMAN:
Strongest expression occurs in promyelocyte and late-myeloblast-like cell lines.

Description:

C/EBP-epsilon C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Belongs to the bZIP family. C/EBP subfamily.

Sequence:
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS

Research Background

Function:

Transcriptional activator (PubMed:26019275). C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Required for the promyelocyte-myelocyte transition in myeloid differentiation (PubMed:10359588).

Post-translational Modifications:

Phosphorylated.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Strongest expression occurs in promyelocyte and late-myeloblast-like cell lines.

Subunit Structure:

Binds DNA as a homodimer and as a heterodimer (PubMed:26019275). Can form stable heterodimers with CEBPA, CEBPB and CEBPD (By similarity). Interacts with GATA1 AND SPI1 (PubMed:26019275). Interacts with SMARCD2 (PubMed:28369036).

Similarity:

Belongs to the bZIP family. C/EBP subfamily.

Research Fields

Research Fields:

· Human Diseases > Cancers: Specific types > Acute myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF0085-BP
(Blocking peptide available as AF0085-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Rabbit
100%
Sheep
100%
Dog
100%
Bovine
100%
Horse
100%
Chicken
0%
Zebrafish
0%
Xenopus
0%
High similarity Medium similarity Low similarity No similarity
Q15744 as Substrate
Site PTM Type Enzyme
T74 Phosphorylation
Y80 Phosphorylation
Y107 Phosphorylation
S108 Phosphorylation
S109 Phosphorylation
K121 Acetylation
K121 Sumoylation
S181 Phosphorylation
S188 Phosphorylation
K198 Acetylation
Y207 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top